LRRC4 Protein, Human (489a.a, HEK293, His)
LRRC4 Protein, Human (489a.a, HEK293, His) is the recombinant human-derived LRRC4 protein, expressed by HEK293, with C-His labeled tag. The total length of LRRC4 Protein, Human (489a.a, HEK293, His) is 489 a.a., with molecular weight of 90-110 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LRRC4 Protein, Human (489a.a, HEK293, His) is the recombinant human-derived LRRC4 protein, expressed by HEK293, with C-His labeled tag. The total length of LRRC4 Protein, Human (489a.a, HEK293, His) is 489 a.a., with molecular weight of 90-110 kDa.
Background
LRRC4 is a synaptic adhesion protein that regulates the formation of excitatory synapses by recruiting pre- and postsynaptic proteins. It organizes the lamina/pathway-specific differentiation of dendrites and plays a crucial role in auditory synaptic responses. Additionally, LRRC4 is involved in the suppression of glioma (By similarity).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
AAI11562 (A39-K527)
-
Molecular Construction
-
N-term
-
LRRC4 (A39-K527)
Accession # AAI11562 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LRRC4; Brain Tumor-Associated Protein BAG; Leucine Rich Repeat Containing 4; Netrin-G Ligand-2; NGL-2; Netrin-G2 Ligand; NAG14; Brain Tumor Associated Protein LRRC4; Nasopharyngeal Carcinoma-Associated Gene 14 Protein; Leucine-Rich Repeat-Containing 4; Leucine-Rich Repeat-Containing Protein 4; BAG
-
AA Sequence
ASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTK
-
Predicted Molecular Mass
55.8 kDa
-
Molecular Weight
Approximately 90-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
