LY6D Protein, Human (HEK293, Fc)
LY6D Protein, Human (HEK293, Fc) is the recombinant human-derived LY6D, expressed by HEK293 , with C-mFc labeled tag. ,
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LY6D Protein, Human (HEK293, Fc) is the recombinant human-derived LY6D, expressed by HEK293 , with C-mFc labeled tag. ,
Background
LY6D may act as a specification marker at the earliest stage of lymphocyte development between B- and T-cells, marking the initial phase of B-cell specification.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
CAA73189.1 (L21-H97)
-
Gene ID8581
-
Protein Length
Full Length of Lymphocyte antigen 6D Chain
-
Synonyms
LY6D; Lymphocyte Antigen 6D; Lymphocyte Antigen 6 Family Member D; E48 Antigen; E48; Ly-6D; Lymphocyte Antigen 6 Complex, Locus D
-
AA Sequence
LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLH
-
Predicted Molecular Mass
34.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
