LY6G6D Protein, Cynomolgus (HEK293, hFc)
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-hFc
-
Accession
XP_014991478.1 (N20-S104)
-
Gene ID715304
-
Protein Length
Partial
-
Synonyms
LY6G6D; Lymphocyte Antigen 6 Complex Locus Protein G6d; Prev. C6orf23; Protein Ly6-D; MEGT1; Lymphocyte Antigen 6 Complex Locus G6D; NG25; Chromosome 6 Open Reading Frame 23; G6D; LY6G6D Protein, Isoform B; Ly6-D; Lymphocyte Antigen-6 G6D; Megakaryocyte-E
-
AA Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
-
Predicted Molecular Mass
34.7 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
