LY6G6F Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
LY6G6F protein participates in signal transduction pathways involving GRB2 and GRB7. Forming homodimers and interacting with GRB2 and GRB7 in a phosphorylation-dependent manner, LY6G6F likely modulates signal transduction cascades, suggesting its involvement in intricate cellular signaling networks. LY6G6F Protein, Human (HEK293, hFc) is the recombinant human-derived LY6G6F protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LY6G6F protein participates in signal transduction pathways involving GRB2 and GRB7. Forming homodimers and interacting with GRB2 and GRB7 in a phosphorylation-dependent manner, LY6G6F likely modulates signal transduction cascades, suggesting its involvement in intricate cellular signaling networks. LY6G6F Protein, Human (HEK293, hFc) is the recombinant human-derived LY6G6F protein, expressed by HEK293 , with C-hFc labeled tag.
Background
LY6G6F protein is suggested to participate in downstream signal transduction pathways that involve GRB2 and GRB7. It forms homodimers through disulfide linkages and interacts with GRB2 and GRB7 in a phosphorylation-dependent manner. These interactions likely contribute to the modulation of signal transduction cascades, highlighting the potential involvement of LY6G6F in intricate cellular signaling networks.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q5SQ64-1 (A17-W235)
-
Molecular Construction
-
N-term
-
LY6G6F (A17-W235)
Accession # Q5SQ64-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LY6G6F; Lymphocyte Antigen 6 Complex, Locus G6F; Prev. C6orf21; Lymphocyte Antigen 6 Complex Locus G6F; Prev. LY6G6D; Chromosome 6 Open Reading Frame 21; NG32; LY6G6; G6f; G6F; Lymphocyte Antigen 6 Complex Locus Protein G6f; Lymphocyte Antigen 6 Family Me
-
AA Sequence
ADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPW
-
Predicted Molecular Mass
50.6 kDa
-
Molecular Weight
Approximately 53-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
