LY6G6F Protein, Human (HEK293, hFc)

LY6G6F protein participates in signal transduction pathways involving GRB2 and GRB7. Forming homodimers and interacting with GRB2 and GRB7 in a phosphorylation-dependent manner, LY6G6F likely modulates signal transduction cascades, suggesting its involvement in intricate cellular signaling networks. LY6G6F Protein, Human (HEK293, hFc) is the recombinant human-derived LY6G6F protein, expressed by HEK293 , with C-hFc labeled tag.

LY6G6F protein is suggested to participate in downstream signal transduction pathways that involve GRB2 and GRB7. It forms homodimers through disulfide linkages and interacts with GRB2 and GRB7 in a phosphorylation-dependent manner. These interactions likely contribute to the modulation of signal transduction cascades, highlighting the potential involvement of LY6G6F in intricate cellular signaling networks.

Human

HEK293

C-hFc

Q5SQ64-1 (A17-W235)

259215  [NCBI]

Extracellular Domain

ADNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPW

53-63 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.