LYVE-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Human (HEK293, His) is the recombinant human-derived LYVE-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Human (HEK293, His) is the recombinant human-derived LYVE-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LYVE-1, a ligand-specific transporter, orchestrates the trafficking of molecules between intracellular organelles, specifically the trans-Golgi network (TGN), and the plasma membrane. Functioning as a key player in the autocrine regulation of cell growth, LYVE-1 is involved in mediating the uptake and catabolism of growth regulators containing a cell surface retention sequence binding (CRS). Additionally, it exhibits potential as a hyaluronan (HA) transporter, participating in the internalization of HA for catabolism within lymphatic endothelial cells or its transport into the lumen of afferent lymphatic vessels, leading to subsequent re-uptake and degradation in lymph nodes. Moreover, LYVE-1 forms homodimers through disulfide linkages and binds to pericellular hyaluronan matrices on leukocytes, facilitating cell adhesion and migration through lymphatic endothelium. It interacts with PDGFB and IGFBP3 and transiently forms a ternary complex with PDGFB and PDGFRB in the TGN.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized hyaluronan at 10 μg/mL (100 μL/well) can bind Biotinylated Human LYVE-1. The ED50 for this effect is 0.816 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH26231.1 (L20-T238)
-
Molecular Construction
-
N-term
-
LYVE-1 (L20-T238)
Accession # AAH26231.1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LYVE1; Hyaluronic Acid Receptor; Prev. XLKD1; HAR; LYVE-1; Cell Surface Retention Sequence Binding Protein-1; Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1; Extracellular Link Domain Containing 1; Extracellular Link Domain-Containing Protein 1;
-
AA Sequence
LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
