M-CSF Protein, Cynomolgus (HEK293, His)
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.
Background
M-CSF Protein assumes a crucial role in orchestrating the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. Its significance extends to promoting the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Moreover, M-CSF is a key player in the regulation of osteoclast proliferation and differentiation, influencing bone resorption and contributing to normal bone development. Beyond its impact on the skeletal system, M-CSF is indispensable for normal male and female fertility. The cytokine also plays a role in lipoprotein clearance and contributes to cellular processes such as reorganizing the actin cytoskeleton, regulating the formation of membrane ruffles, cell adhesion, and cell migration. M-CSF can exist in various forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. It interacts with its receptor CSF1R to exert its diverse functions.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_045221641.1 (E33-L255)
-
Molecular Construction
-
N-term
-
M-CSF (E33-L255)
Accession # XP_045221641.1 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo
-
AA Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQREGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRRRRRSRQEPQRADSPLEQPEGSPLTQDEDRQVEL
-
Predicted Molecular Mass
26.3 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)