Major urinary protein 2 Protein, Mouse (P.pastoris, His)
Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.
Background
The Major Urinary Protein 2 (MUP2) plays a crucial role in chemical communication by binding to pheromones released from drying urine of males. This specific interaction with male-derived pheromones is instrumental in influencing the sexual behavior of females. MUP2's ability to bind to these pheromones underscores its essential function in mediating chemical signaling and communication within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-His
-
Accession
P11589 (E19-E180)
-
Gene ID17841 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
Mup2 (E19-E180)
Accession # P11589 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Major urinary protein 2; MUP 2; Mup2
-
AA Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
-
Predicted Molecular Mass
20.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
