MAP1LC3B Protein, Human (His)
MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human (His) is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with C-His.
- Species: Human
- Source: E. coli
Biological Activity
MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human (His) is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with C-His.
MAP1LC3B, a ubiquitin-like modifier, plays a pivotal role in autophagosomal vacuole formation, contributing to cellular homeostasis. Engaging in mitophagy, it regulates mitochondrial quantity and quality, preventing excess reactive oxygen species production and ensuring energy efficiency. During cellular stress, it binds C-18 ceramides, anchoring autophagolysosomes to outer mitochondrial membranes, facilitating damaged mitochondria elimination. Distinct from LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily, to which MAP1LC3B belongs, is crucial for later-stage autophagosome maturation. MAP1LC3B further promotes primary ciliogenesis and orchestrates the remodeling of endoplasmic reticulum subdomains into autophagosomes via interactions with TEX264. In response to nutrient stress, it recruits cofactor JMY, enhancing actin nucleation and autophagosome biogenesis. This versatile protein interacts with a multitude of partners, including SQSTM1 for inclusion body degradation, ATG13, MAPK15, BNIP3, KEAP1, PCM1, and TBC1D5, highlighting its involvement in diverse cellular processes and signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9GZQ8 (M1-V125)
-
Gene ID81631
-
Molecular Construction
-
N-term
-
His
-
MAP1LC3B (M1-V125)
Accession # Q9GZQ8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MAP1LC3B; CDNA FLJ77661, Highly Similar To Homo Sapiens Microtubule-Associated Protein 1 Light Chain 3 Beta(MAP1LC3B), MRNA; Microtubule Associated Protein 1 Light Chain 3 Beta; Microtubule-Associated Protein 1 Light Chain 3 Beta, Isoform CRA_b; ATG8F; Mi
-
AA Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)