MARCO Protein, Cynomolgus (HEK293, His)
MARCO Protein exhibits a deficiency in conserved residue(s) essential for feature annotation propagation. MARCO Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MARCO protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MARCO Protein exhibits a deficiency in conserved residue(s) essential for feature annotation propagation. MARCO Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived MARCO protein, expressed by HEK293 , with N-His labeled tag.
Background
The MARCO protein is characterized by a deficiency in conserved residue(s) crucial for the propagation of feature annotation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-His
-
Accession
A0A2K5X0Z2-1 (M79-I520)
-
Gene ID102137861
-
Molecular Construction
-
N-term
-
His
-
MARCO (M69-I520)
Accession # A0A2K5X0Z2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MARCO; Scavenger Receptor Class A, Member 2; Macrophage Receptor With Collagenous Structure; Macrophage Receptor MARCO; SCARA2; Scavenger Receptor Class A Member 2; SR-A6; Macrophage Receptor
-
AA Sequence
MYLLNDTLSAEDSLPFSLLRSTHSGERLAQAASRLQVLQSQLTWVRVSHEHLLQRVDNFTQNPGMFGIKGEQGPPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAAGRDGATGPPGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGDKGDLGLPGSKGDKGMKGDAGVMGPPGAQGSKGDSGRPGSPGLAGFPGAKGDPGQPGLQGVPGPPGAVGQPGAKGEPGSAGSRGLTGLPGSPGSPGAAGLKGSKGDTGLQGQQGVKGEPGVPGPAGVKGEQGSPGLAGSKGAPGRAGQKGDQGVKGSSGERGVKGEKGETGENAVSVRIVGSSNRGRAEVYYGGTWGTICDDEWHNSDATVFCRMLGYSRGRALYKVGAGTGQIWLDNVQCRGTESTLWSCSKNSWGSHDCSHEEDAGVECSI
-
Predicted Molecular Mass
45.6 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
