MARCO Protein, Human (442a.a, HEK293, His)
Based on 1 Customer Validation
MARCO Protein, a pattern recognition receptor (PRR), binds both Gram-positive and Gram-negative bacteria, facilitating unopsonized particle binding by alveolar macrophages. It also interacts with the secretoglobin SCGB3A2. Forming disulfide-linked homotrimer structures, MARCO Protein's trimers assemble into larger oligomers, providing an expansive surface area for interactions with substantial ligands. MARCO Protein, Human (442a.a, HEK293, His) is the recombinant human-derived MARCO protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MARCO Protein, a pattern recognition receptor (PRR), binds both Gram-positive and Gram-negative bacteria, facilitating unopsonized particle binding by alveolar macrophages. It also interacts with the secretoglobin SCGB3A2. Forming disulfide-linked homotrimer structures, MARCO Protein's trimers assemble into larger oligomers, providing an expansive surface area for interactions with substantial ligands. MARCO Protein, Human (442a.a, HEK293, His) is the recombinant human-derived MARCO protein, expressed by HEK293, with N-His labeled tag.
Background
MARCO Protein is a pattern recognition receptor (PRR) that can bind both Gram-positive and Gram-negative bacteria. It also plays a role in binding unopsonized particles by alveolar macrophages. Additionally, MARCO Protein is capable of binding to the secretoglobin SCGB3A2. It forms a homotrimer structure that is disulfide-linked, and these trimers can assemble into larger oligomers, creating a large surface area suitable for interacting with very large ligands.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q9UEW3 (M79-V520)
-
Gene ID8685
-
Molecular Construction
-
N-term
-
His
-
MARCO (M79-V520)
Accession # Q9UEW3 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
MARCO; Scavenger Receptor Class A, Member 2; Macrophage Receptor With Collagenous Structure; Macrophage Receptor MARCO; SCARA2; Scavenger Receptor Class A Member 2; SR-A6; Macrophage Receptor
-
AA Sequence
MYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQGQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQGRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
-
Predicted Molecular Mass
45.9 kDa
-
Molecular Weight
Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
