MASP2 Protein, Rat (His)
Mannan-binding lectin serine protease 2 (MASP2) is a protein defective in conserved residues required for propagation of signature annotations. Specific residues missing in MASP2 prevent the propagation of certain functional features associated with this protein. MASP2 Protein, Rat (His) is the recombinant rat-derived MASP2 protein, expressed by E. coli , with C-His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Mannan-binding lectin serine protease 2 (MASP2) is a protein defective in conserved residues required for propagation of signature annotations. Specific residues missing in MASP2 prevent the propagation of certain functional features associated with this protein. MASP2 Protein, Rat (His) is the recombinant rat-derived MASP2 protein, expressed by E. coli , with C-His labeled tag.
Mannan-binding lectin serine protease 2 (MASP2) is a protein that exhibits a deficiency in the conserved residue(s) required for propagating feature annotation. The specific residue(s) that are missing in MASP2 hinder the propagation of certain functional characteristics associated with this protein. MASP2 is a serine protease that plays a crucial role in the lectin pathway of the complement system, which is a part of the innate immune response. The lectin pathway is activated by the binding of MASP2 to specific carbohydrates on pathogen surfaces, leading to the activation of complement components and subsequent immune responses. The impact of the deficient residue(s) in MASP2 on its function and the lectin pathway needs further exploration to better understand its implications on immune responses mediated by MASP2.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag C-6*His
-
Accession
A2VCV7 (T287-F685)
-
Molecular Construction
-
N-term
-
MASP2 (T287-F685)
Accession # A2VCV7 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MASP2; Mannan-Binding Lectin Serine Protease 1 Pseudogene 1; Prev. MASP1P1; Mannose-Binding Lectin Associated Protein 19; Mannan-Binding Lectin Serine Protease 2; MBL-Associated Serine Protease 2; Mannose-Binding Protein-Associated Serine Protease 2; MASP
-
AA Sequence
TGWKIHYTSTAQPCPDPTAPPNGHISPVQATYVLKDSFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPIPECSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSSKGEKSLPVCKPVCGLSTHTSGGRIIGGQPAKPGDFPWQVLLLGETTAAGALIHDDWVLTAAHAVYGKTEAMSSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKNKVTINRNIMPICLPRKEAASLMKTDFVGTVAGWGLTQKGFLARNLMFVDIPIVDHQKCATAYTKQPYPGAKVTVNMLCAGLDAGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCGGSEQYGVYTKVTNYIPWIENIINNF
-
Predicted Molecular Mass
46.7 kDa
-
Molecular Weight
Approximately 15-20 kDa & 25-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
