1. Recombinant Proteins
  2. Complement System
  3. MASP-2
  4. MASP2 Protein, Rat (His)

Mannan-binding lectin serine protease 2 (MASP2) is a protein defective in conserved residues required for propagation of signature annotations. Specific residues missing in MASP2 prevent the propagation of certain functional features associated with this protein. MASP2 Protein, Rat (His) is the recombinant rat-derived MASP2 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mannan-binding lectin serine protease 2 (MASP2) is a protein defective in conserved residues required for propagation of signature annotations. Specific residues missing in MASP2 prevent the propagation of certain functional features associated with this protein. MASP2 Protein, Rat (His) is the recombinant rat-derived MASP2 protein, expressed by E. coli , with C-His labeled tag.

Background

Mannan-binding lectin serine protease 2 (MASP2) is a protein that exhibits a deficiency in the conserved residue(s) required for propagating feature annotation. The specific residue(s) that are missing in MASP2 hinder the propagation of certain functional characteristics associated with this protein. MASP2 is a serine protease that plays a crucial role in the lectin pathway of the complement system, which is a part of the innate immune response. The lectin pathway is activated by the binding of MASP2 to specific carbohydrates on pathogen surfaces, leading to the activation of complement components and subsequent immune responses. The impact of the deficient residue(s) in MASP2 on its function and the lectin pathway needs further exploration to better understand its implications on immune responses mediated by MASP2.

Species

Rat

Source

E. coli

Tag

C-6*His

Accession

A2VCV7 (T287-F685)

Gene ID
Molecular Construction
N-term
MASP2 (T287-F685)
Accession # A2VCV7
6*His
C-term
Protein Length

Partial

Synonyms
MAP19; MASP-2; MASP1P1; sMap
AA Sequence

TGWKIHYTSTAQPCPDPTAPPNGHISPVQATYVLKDSFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPIPECSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSSKGEKSLPVCKPVCGLSTHTSGGRIIGGQPAKPGDFPWQVLLLGETTAAGALIHDDWVLTAAHAVYGKTEAMSSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKNKVTINRNIMPICLPRKEAASLMKTDFVGTVAGWGLTQKGFLARNLMFVDIPIVDHQKCATAYTKQPYPGAKVTVNMLCAGLDAGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCGGSEQYGVYTKVTNYIPWIENIINNF

Predicted Molecular Mass
46.7 kDa
Molecular Weight

Approximately 15-20 kDa&25-30 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MASP2 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MASP2 Protein, Rat (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MASP2 Protein, Rat (His)
Cat. No.:
HY-P77801
Quantity:
MCE Japan Authorized Agent: