MASP2 Protein, Rat (His)

Mannan-binding lectin serine protease 2 (MASP2) is a protein defective in conserved residues required for propagation of signature annotations. Specific residues missing in MASP2 prevent the propagation of certain functional features associated with this protein. MASP2 Protein, Rat (His) is the recombinant rat-derived MASP2 protein, expressed by E. coli , with C-His labeled tag.

Mannan-binding lectin serine protease 2 (MASP2) is a protein that exhibits a deficiency in the conserved residue(s) required for propagating feature annotation. The specific residue(s) that are missing in MASP2 hinder the propagation of certain functional characteristics associated with this protein. MASP2 is a serine protease that plays a crucial role in the lectin pathway of the complement system, which is a part of the innate immune response. The lectin pathway is activated by the binding of MASP2 to specific carbohydrates on pathogen surfaces, leading to the activation of complement components and subsequent immune responses. The impact of the deficient residue(s) in MASP2 on its function and the lectin pathway needs further exploration to better understand its implications on immune responses mediated by MASP2.

Rat

E. coli

C-6*His

A2VCV7 (T287-F685)

64459  [NCBI]

Partial

TGWKIHYTSTAQPCPDPTAPPNGHISPVQATYVLKDSFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPIPECSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSSKGEKSLPVCKPVCGLSTHTSGGRIIGGQPAKPGDFPWQVLLLGETTAAGALIHDDWVLTAAHAVYGKTEAMSSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKNKVTINRNIMPICLPRKEAASLMKTDFVGTVAGWGLTQKGFLARNLMFVDIPIVDHQKCATAYTKQPYPGAKVTVNMLCAGLDAGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCGGSEQYGVYTKVTNYIPWIENIINNF

Approximately 15-20 kDa&25-30 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.