Copy Link Print Information

MBL2/COLEC1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • MBL2/COLEC1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MBL2, also known as COLEC1, is a calcium-dependent lectin actively involved in innate immune defense. This versatile protein binds to mannose, fucose, and N-acetylglucosamine on diverse microorganisms, initiating the lectin complement pathway. Furthermore, MBL2 exhibits a unique affinity for late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their efficient uptake by macrophages. Additionally, there is evidence suggesting its potential binding to DNA. In the context of SARS coronavirus-2 (SARS-CoV-2) infection, MBL2 plays a critical role in activating the complement lectin pathway, leading to the inhibition of SARS-CoV-2 infection and a reduction in the induced inflammatory response. Structurally, MBL2 forms oligomeric complexes composed of three or more homotrimers. Its functional interactions extend to MASP1, MASP2, MEP1A, MEP1B, and CR1, indicating its involvement in various regulatory and immune-related pathways.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P11226 (E21-I248)

  • Gene ID
    4153  [NCBI]
  • Molecular Construction
    • N-term
    • MBL2 (E21-I248)
      Accession # P11226
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    MBL2; Mannose-Binding Lectin (Protein C) 2, Soluble; Prev. MBL; Mannose-Binding Lectin; COLEC1; Mannan-Binding Protein; MBP-C; Mannose Binding Lectin; MBP1; Mannan-Binding Lectin; MBP; Collectin 1; Mannose-Binding Lectin (Protein C) 2, Soluble (Opsonic De

  • AA Sequence

    ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

  • Predicted Molecular Mass

    25.1 kDa

  • Molecular Weight

    Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% Threhalose, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • MBL2/COLEC1 Protein, Human (HEK293, His) Product Image
    1/16
  • MBL2/COLEC1 Protein, Human (HEK293, His) Product Image