MBP Protein, Mouse (P.pastoris, His)
MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability. In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes. MBP Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MBP protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MBP proteins, especially the classical isoforms 4-13, dominate myelin membranes in the central nervous system and are critical for myelination and stability. In contrast, the non-canonical isoform 1-3/Golli-MBP may be involved in early brain development and contribute to transcriptional complexes that influence multiple cellular processes. MBP Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived MBP protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
The classic group of MBP isoforms (isoform 4-isoform 13) stands as the predominant protein constituents alongside PLP in the myelin membrane of the central nervous system (CNS), playing vital roles in both the formation and stabilization of the myelin sheath. Conversely, the non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may be particularly involved in the early stages of brain development, preceding myelination. These isoforms potentially function as components of transcriptional complexes, contributing to intricate cellular processes. Moreover, members of the non-classic group may participate in signaling pathways within T-cells and neural cells. The extensive repertoire of isomers resulting from differential splicing events and optional post-translational modifications adds complexity, with each isomer potentially serving specialized functions. The MBP protein forms homodimers, further contributing to its diverse functional roles.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P04370 (M1-R250)
-
Gene ID17196
-
Molecular Construction
-
N-term
-
6*His
-
MBP (M1-R250)
Accession # P04370 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MBP; Myelin A1 Protein; Myelin Basic Protein; Golli-MBP; Myelin Membrane Encephalitogenic Protein
-
AA Sequence
MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR
-
Predicted Molecular Mass
29.2 kDa
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
