1. Recombinant Proteins
  2. Others
  3. MC4R Protein, Human (sf9, Flag, His)

MC4R Protein, Human (sf9, Flag, His) is the recombinant human-derived MC4R, expressed by sf9 insect cells , with His, Flag labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MC4R Protein, Human (sf9, Flag, His) is the recombinant human-derived MC4R, expressed by sf9 insect cells , with His, Flag labeled tag. ,

Background

MC4R, a receptor specific to the heptapeptide core shared by adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH, plays a pivotal role in regulating energy homeostasis and somatic growth. Mediated by G proteins that stimulate adenylate cyclase to generate cAMP, this receptor forms homodimers that are disulfide-linked and can further assemble into higher-order oligomers. MC4R interacts with ATRNL1 and engages in an interaction with MGRN1, inhibiting agonist-induced cAMP production by competing with GNAS-binding. Additionally, it forms complexes with MRAP and MRAP2, enhancing ligand sensitivity and cAMP generation, thereby contributing to its multifaceted regulatory functions.

Species

Human

Source

Sf9 insect cells

Tag

His;Flag

Accession

P32245 (W16-L221, Q237-Y320, E49V, N97L, S99F, S131A, D298N)

Gene ID

4160

Protein Length

Partial

Synonyms
Melanocortin receptor 4; MC4R; Homo sapiens; Human; MC4-R; G-protein coupled receptor; Receptor; Transducer
AA Sequence

QGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIINPLIYALRSQELRKTFKEIICCY

Predicted Molecular Mass
57.6 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MC4R Protein, Human (sf9, Flag, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MC4R Protein, Human (sf9, Flag, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MC4R Protein, Human (sf9, Flag, His)
Cat. No.:
HY-P703161
Quantity:
MCE Japan Authorized Agent: