MC4R Protein, Human (sf9, Flag, His)
MC4R Protein, Human (sf9, Flag, His) is the recombinant human-derived MC4R, expressed by sf9 insect cells , with His, Flag labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MC4R Protein, Human (sf9, Flag, His) is the recombinant human-derived MC4R, expressed by sf9 insect cells , with His, Flag labeled tag. ,
Background
MC4R, a receptor specific to the heptapeptide core shared by adrenocorticotropic hormone and alpha-, beta-, and gamma-MSH, plays a pivotal role in regulating energy homeostasis and somatic growth. Mediated by G proteins that stimulate adenylate cyclase to generate cAMP, this receptor forms homodimers that are disulfide-linked and can further assemble into higher-order oligomers. MC4R interacts with ATRNL1 and engages in an interaction with MGRN1, inhibiting agonist-induced cAMP production by competing with GNAS-binding. Additionally, it forms complexes with MRAP and MRAP2, enhancing ligand sensitivity and cAMP generation, thereby contributing to its multifaceted regulatory functions.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;Flag
-
Accession
P32245 (W16-L221, Q237-Y320, E49V, N97L, S99F, S131A, D298N)
-
Gene ID4160
-
Protein Length
Partial
-
Synonyms
MC4R; Mutated Melanocortin Receptor 4; Melanocortin 4 Receptor; Mutant Melanocortin-4 Receptor; Melanocortin Receptor 4; BMIQ20; MC4-R
-
AA Sequence
QGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIINPLIYALRSQELRKTFKEIICCY
-
Predicted Molecular Mass
57.6 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
