Copy Link Print Information

MCEMP1 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MCEMP1 Protein, Human (HEK293, Fc)
  • MCEMP1 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells and plays a critical in allergic and inflammatory lung diseases. MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes[1][2]. MCEMP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MCEMP1 protein, expressed by HEK293 , with N-mFc labeled tag.

Background

MCEMP1, a lung-specific surface protein, is a type II transmembran protein. MCEMP1 is primarily expressed in myeloid lineage immune cells, such as lung-resident mast cells and alveolar macrophages. MCEMP1 is an inducible genes in many inflammatory diseases, and plays a critical in allergic and inflammatory lung diseases[1].
In function, MCEMP1 is an adaptor for KIT receptor to promotes stem cell factor-mediated mast cell proliferation. MCEMP1 signals through its cytoplasmic immunoreceptor tyrosine-based activation motif and forms a complex with KIT to enhance its autophosphorylation and activation[1]. MCEMP1 also participates in the chemotaxis, adhesion, and migration of circulating monocytes[2].Human MCEMP1 shares about 40% aa sequence identity with mouse and rat. Rat MCEMP1 shares about 78% aa sequence identity with mouse.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.2521 μg/mL, corresponding to a specific activity is 3.967×10^3 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.2521 μg/mL, corresponding to a specific activity is 3.967×103 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-mFc
  • Accession

    Q8IX19-1 (K107-Q187)

  • Gene ID
    199675  [NCBI]
  • Molecular Construction
    • N-term
    • mFc
    • MCEMP1 (K107-Q187)
      Accession # Q8IX19
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MCEMP1; Mast Cell-Expressed Membrane Protein 1; Prev. C19orf59; Mast Cell-Expressed Membrane Protein 1, Isoform CRA_a; Epididymis Secretory Sperm Binding Protein; Chromosome 19 Open Reading Frame 59; Mast Cell Expressed Membrane Protein 1; MGC132456

  • AA Sequence

    KNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ

  • Molecular Weight

    Approximately 44 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.2521 μg/mL, corresponding to a specific activity is 3.967×103 units/mg.

  • MCEMP1 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for MCEMP1 Protein, Human (HEK293, Fc)
  • MCEMP1 Protein, Human (HEK293, Fc) Product Image