MDP1 Protein, Human (HEK293, His)
MDP1 Protein, a magnesium-dependent phosphatase, potentially functions as a tyrosine phosphatase. MDP1 Protein, Human (HEK293, His) is the recombinant human-derived MDP1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MDP1 Protein, a magnesium-dependent phosphatase, potentially functions as a tyrosine phosphatase. MDP1 Protein, Human (HEK293, His) is the recombinant human-derived MDP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
MDP1 Protein, identified as a magnesium-dependent phosphatase, exhibits potential tyrosine phosphatase activity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q86V88-1 (M1-A176)
-
Molecular Construction
-
N-term
-
MDP1 (M1-A176)
Accession # Q86V88-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MDP1; Fructosamine-6-Phosphatase; Magnesium Dependent Phosphatase 1; MGC5987; FN6Pase; MDP-1; Magnesium-Dependent Phosphatase 1
-
AA Sequence
MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
-
Predicted Molecular Mass
21.1 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
