Mesothelin Protein, Human (112a.a, Biotinylated, HEK293, His, Avi)
Mesothelin Protein, especially in its membrane-anchored forms, potentially mediates cellular adhesion, implicating its role in cell interactions. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) actively enhances in vitro megakaryocyte colony formation, indicating its participation in fostering specialized blood cell colonies' development. Mesothelin Protein, Human (112a.a, Biotinylated, HEK293, His, Avi) is the recombinant human-derived Mesothelin protein, expressed by HEK293, with C-Avi and C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Mesothelin Protein, especially in its membrane-anchored forms, potentially mediates cellular adhesion, implicating its role in cell interactions. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) actively enhances in vitro megakaryocyte colony formation, indicating its participation in fostering specialized blood cell colonies' development. Mesothelin Protein, Human (112a.a, Biotinylated, HEK293, His, Avi) is the recombinant human-derived Mesothelin protein, expressed by HEK293, with C-Avi and C-His labeled tag.
Background
Mesothelin Protein, particularly in its membrane-anchored forms, exhibits a potential role in cellular adhesion, suggesting involvement in mediating interactions between cells. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) has been identified as a potent enhancer of megakaryocyte colony formation in vitro, indicating its active participation in fostering the development of these specialized blood cell colonies.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q13421-3 (M487-S598)
-
Gene ID10232
-
Molecular Construction
-
N-term
-
Mesothelin (M487-S598)
Accession # Q13421-3 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
MSLN; CAK1; Mesothelin; Soluble MPF Mesothelin Related Protein; MPF; Megakaryocyte Potentiating Factor; Pre-Pro-Megakaryocyte-Potentiating Factor; SMRP; CAK1 Antigen
-
AA Sequence
MNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALS
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
