1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. MGLL Protein, Human

MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human is the recombinant human-derived MGLL protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human is the recombinant human-derived MGLL protein, expressed by E. coli , with tag free.

Background

MGLL, a pivotal enzyme in lipid metabolism, serves as a key catalyst in the conversion of monoacylglycerides into free fatty acids and glycerol, as evidenced by its documented roles in various studies. Beyond its involvement in lipid metabolism, MGLL exhibits the ability to hydrolyze the endocannabinoid 2-arachidonoylglycerol, thereby contributing significantly to the intricate regulation of endocannabinoid signaling and influencing nociperception and the perception of pain. Notably, MGLL plays a crucial role in regulating the levels of fatty acids, which act as essential signaling molecules with implications for diverse cellular functions. This enzyme's impact extends to cancer biology, where it is implicated in the promotion of cancer cell migration, invasion, and overall tumor growth, as indicated by various studies.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99685 (P2-P303)

Gene ID

11343

Molecular Construction
N-term
MGLL (P2-P303)
Accession # Q99685
C-term
Protein Length

Partial

Synonyms
MGLL; Monoglyceride lipase; MGL; HU-K5; Lysophospholipase homolog; Lysophospholipase-like; Monoacylglycerol lipase; MAGL
AA Sequence

PEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MGLL Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MGLL Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGLL Protein, Human
Cat. No.:
HY-P701984
Quantity:
MCE Japan Authorized Agent: