MGLL Protein, Human
MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human is the recombinant human-derived MGLL protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MGLL proteins convert monoacylglycerides into free fatty acids and glycerol. MGLL Protein, Human is the recombinant human-derived MGLL protein, expressed by E. coli , with tag free.
MGLL, a pivotal enzyme in lipid metabolism, serves as a key catalyst in the conversion of monoacylglycerides into free fatty acids and glycerol, as evidenced by its documented roles in various studies. Beyond its involvement in lipid metabolism, MGLL exhibits the ability to hydrolyze the endocannabinoid 2-arachidonoylglycerol, thereby contributing significantly to the intricate regulation of endocannabinoid signaling and influencing nociperception and the perception of pain. Notably, MGLL plays a crucial role in regulating the levels of fatty acids, which act as essential signaling molecules with implications for diverse cellular functions. This enzyme's impact extends to cancer biology, where it is implicated in the promotion of cancer cell migration, invasion, and overall tumor growth, as indicated by various studies.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q99685 (P2-P303)
-
Gene ID11343
-
Molecular Construction
-
N-term
-
MGLL (P2-P303)
Accession # Q99685 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MGLL; Monoglyceride lipase; MGL; HU-K5; Lysophospholipase homolog; Lysophospholipase-like; Monoacylglycerol lipase; MAGL
-
AA Sequence
PEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
