MICA Protein, Human (179a.a, HEK293, His)
MICA protein is recognized by γδ T cells as a stress-induced autoantigen independent of antigen presentation. As a ligand for the KLRK1/NKG2D receptor, MICA binding triggers cell lysis. MICA Protein, Human (179a.a, HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MICA protein is recognized by γδ T cells as a stress-induced autoantigen independent of antigen presentation. As a ligand for the KLRK1/NKG2D receptor, MICA binding triggers cell lysis. MICA Protein, Human (179a.a, HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293, with C-His labeled tag.
Background
MICA Protein is devoid of a role in antigen presentation and functions as a stress-induced self-antigen recognized by gamma delta T-cells. Serving as a ligand for the KLRK1/NKG2D receptor, its binding to KLRK1 triggers cell lysis. Unlike classical MHC class I molecules, MICA does not form a heterodimer with beta-2-microglobulin but instead binds as a monomer to a KLRK1/NKG2D homodimer. KLRK1 forms a complex with HCST/DAP10, wherein KLRK1 binds MICA, and HCST acts as an adapter molecule facilitating signal transduction. Notably, MICA interacts with PDIA6 on the surface of tumor cells, leading to disulfide bond reduction necessary for the release of MICA from tumor cells. Additionally, MICA interacts with the human cytomegalovirus/HHV-5 protein UL142.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q29983-1 (E24-R202)
-
Gene ID100507436
-
Molecular Construction
-
N-term
-
MICA (E24-R202)
Accession # Q29983-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
MICA; MHC Class I Related Chain A Isoform B1; MHC Class I Polypeptide-Related Sequence A; MHC Class I Related Chain A Isoform B2; PERB11.1; MHC Class I Related Chain A Isoform C; Major Histocompatibility Complex Class I Chain-Related Protein A; MHC Class
-
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLR
-
Predicted Molecular Mass
22.8 kDa
-
Molecular Weight
Approximately 31-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
