1. Recombinant Proteins
  2. Others
  3. MICA Protein, Human (179a.a, HEK293, His)

MICA protein is recognized by γδ T cells as a stress-induced autoantigen independent of antigen presentation. As a ligand for the KLRK1/NKG2D receptor, MICA binding triggers cell lysis. MICA Protein, Human (179a.a, HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MICA protein is recognized by γδ T cells as a stress-induced autoantigen independent of antigen presentation. As a ligand for the KLRK1/NKG2D receptor, MICA binding triggers cell lysis. MICA Protein, Human (179a.a, HEK293, His) is the recombinant human-derived MICA protein, expressed by HEK293, with C-His labeled tag.

Background

MICA Protein is devoid of a role in antigen presentation and functions as a stress-induced self-antigen recognized by gamma delta T-cells. Serving as a ligand for the KLRK1/NKG2D receptor, its binding to KLRK1 triggers cell lysis. Unlike classical MHC class I molecules, MICA does not form a heterodimer with beta-2-microglobulin but instead binds as a monomer to a KLRK1/NKG2D homodimer. KLRK1 forms a complex with HCST/DAP10, wherein KLRK1 binds MICA, and HCST acts as an adapter molecule facilitating signal transduction. Notably, MICA interacts with PDIA6 on the surface of tumor cells, leading to disulfide bond reduction necessary for the release of MICA from tumor cells. Additionally, MICA interacts with the human cytomegalovirus/HHV-5 protein UL142.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q29983-1 (E24-R202)

Gene ID

100507436

Molecular Construction
N-term
MICA (E24-R202)
Accession # Q29983-1
C-term
Protein Length

Partial

Synonyms
MHC Class I Polypeptide-Related Sequence A; L MIC-A; L MICA; L PERB11.1
AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLR

Predicted Molecular Mass
22.8 kDa
Molecular Weight

Approximately 31-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MICA Protein, Human (179a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MICA Protein, Human (179a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MICA Protein, Human (179a.a, HEK293, His)
Cat. No.:
HY-P704225
Quantity:
MCE Japan Authorized Agent: