1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL9
  6. MIG/CXCL9 Protein, Rhesus Macaque

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis. MIG/CXCL9 Protein, Rhesus Macaque is produced in E.coil, and consists of 103 amino acids (T23-T125).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL9, also known as MIG, is one member of the ELR-negative CXC chemokine subfamily, and can be induced by IFN-γ. CXCL9 binds to its receptor CXCR3 and can recruit CXCR3+ cells, such as effector T cells, regulatory T cells (Tregs) and CD8+ cytotoxic T cells. CXCL9 is involved in immunoregulatory and inflammatory processes, but it also play a key role in tumor growth, angiogenesis, and metastasis[1][2]. MIG/CXCL9 Protein, Rhesus Macaque is produced in E.coil, and consists of 103 amino acids (T23-T125).

Background

CXCL9 is a member of the CXC family and has an important role in the chemotaxis of immune cells. It is secreted by various cell types including immune cells (T lymphocytes, NK cells, dendritic cells, macrophages, eosinophils, etc.), and non-immune cells (hepatic stellate cells, preadipocytes, thyrocytes, endothelial cell, tumor cells, and fibroblasts, etc)[1].
The amino acid sequence of human CXCL9 protein has low homology between mouse and rat CXCL9 protein.
CXCL9 is one of the ligands of chemokine receptor CXCR3 that mediates the infiltration of lymphocytes to focal sites and suppresses tumor growth. CXCL9 attracts CXCR3- (CXCR3-A and CXCR3-B) T lymphocytes, is involved in the pathogenesis of a variety of physiologic diseases during their initiation and their maintenance. The transcriptional regulation of CXCL9 is a multistep process involving many transcription factors, of which STAT1 and NF-κB are two most well-characterized members. Both the gene mutation of STAT1 and the blocking of the JA/STAT1 pathway can reduce CXCL9 expression induced by IFN-γ. Moreover, CXCL9 expression can be suppressed by reducing the levels of components of the STAT1-IRF‐1 transcriptional activation pathway by Porphyromonas gingivalis that leads to the immune function decline. Lipopolysaccharide (LPS) and D-galactosamine could induce the phosphorylation of STAT1 and enhance the transcription of CXCL9 leading to the enhancement of liver inflammation, and even liver apoptosis and injury[1][2][3].
CXCL9 could promote cancer metastasis via enhanced migration and invasion of tumor cells, and breaking of the endothelial cells monolayer. However, as a tumor suppressor, it mainly recruited tumor-infiltrating CD8+ T cells and NK cells, and inhibited tumor angiogenesis. In Addition, IL-12 and Th1-derived IFN-γ exerted antitumor effects through the inhibitory effects of endogenous CXCL9 on tumor vasculature in human Burkitt's lymphoma. In cutaneous T-cell lymphoma, expression of CXCL9 was found at early stage but low at advanced stage. CXCL9 is also associated with human hepatic fibrosis and anti-fibrosis in mice. Furthermore, CXCL9 is highly expressed in atherosclerotic plaques of coronary arteries and specifically recruits CXCR3-bearing Th1 cells that increase the risk of plaque progression and the occurrences of myocardial infarction[1][2][3][4].

Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

Q8MIZ2 (T23-T125)

Gene ID
Molecular Construction
N-term
CXCL9 (T23-T125)
Accession # Q8MIZ2
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-X-C motif chemokine 9; HuMIG; MIG; CXCL9; CMK; SCYB9
AA Sequence

TPVMRKGRCSCINTNQGTIHLQSLKDLKQFAPNLSCEKTEIIATLKNGDQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRPQQKKTT

Predicted Molecular Mass
11.9 kDa
Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

MIG/CXCL9 Protein, Rhesus Macaque Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MIG/CXCL9 Protein, Rhesus Macaque

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIG/CXCL9 Protein, Rhesus Macaque
Cat. No.:
HY-P77086
Quantity:
MCE Japan Authorized Agent: