MMP-1 Protein, Human (HEK293, C-His)

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-1, expressed by HEK293, with C-6*His labeled tag.

Matrix metalloproteinase-1 (MMP-1) is a proteolytic enzyme known for its role in extracellular matrix remodeling. It exhibits a broad substrate specificity, cleaving collagens of types I, II, and III at a specific site within the helical domain. Additionally, MMP-1 demonstrates activity against collagens of types VII and X. Notably, in the context of HIV infection, MMP-1 interacts with and cleaves the secreted viral Tat protein, resulting in a decrease in neuronal Tat-mediated neurotoxicity. This interaction underscores the diverse functions of MMP-1 beyond its canonical role in extracellular matrix degradation, implicating it in processes associated with viral infection and neuroprotection (

Measured by its ability to cleave 20 µM fluorogenic peptide substrate, Mca-KPLGL-Dpa-AR-NH2 that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is >4000 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)

Materials
Assay buffer: 50 mM Tris, 10 mM CaCl₂, 150 mM NaCl, 0.05% (w/v) Brij-35, pH 7.5 (TCNB)
Test Protein: MMP-1 Protein, Human (HEK293, C-His) (HY-P70250A)
Activator: 4-Aminophenylmercuriacetic acid (APMA, HY-148905), dissolved in DMSO to 100 mM
Substrate: MCA-Lys-Pro-Leu-Gly-Leu-DPA-Ala-Arg-NH₂< (HY-131498)
Standard: MCA-Pro-Leu-OH

Procedure
1. Standard curve: Dilute MCA-Pro-Leu-OH to concentrations of 0, 1.5625, 3.125, 6.25, 12.5, 25, 50, and 100 μmol/L using assay buffer. Add 100 μL of each dilution to black microplate wells. Read at 320 nm excitation and 405 nm emission (top read) in kinetic mode for 5 minutes. Plot the standard curve with measured RFU on the y-axis and standard substance amount on the x-axis to derive the standard curve equation.
2. Resuspend proteins in water to 200 μg/mL. Dilute Human MMP-1 to 50 μg/mL using assay buffer containing 1 mM APMA.
3. Activation: Incubate at 37°C for 2 hours.
4. Dilute the activated Human MMP-1 protein to 1 ng/μL using buffer.
5. Dilute the substrate to 20 μM using assay buffer.
6. Experimental group: 50 μL, 1 ng/μL Human MMP-1 protein + 50 μL, 20 μM substrate.
Control group: 50 μL, 20 μM substrate + 50 μL buffer.
7. Read for 5 minutes in kinetic mode at excitation and emission wavelengths of 320 nm and 405 nm respectively.
8. Calculate specific activity:

Human

HEK293

C-6*His

P03956 (F20-N469)

4312

Full Length of Mature Protein

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Approximately 51-61 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.