1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-19
  5. MMP-19 Protein, Human

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
> 500 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

Background

MMP-19 (Matrix Metalloproteinase-19) is an endopeptidase with a crucial role in degrading various components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (COMP), particularly during development, haemostasis, and pathological conditions such as arthritic diseases. Additionally, MMP-19 may contribute to neovascularization or angiogenesis, suggesting its involvement in processes associated with new blood vessel formation. The enzyme exhibits a broad substrate specificity, hydrolyzing key extracellular matrix proteins, such as collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin. MMP-19's ability to cleave diverse substrates underscores its significance in tissue remodeling and repair, as well as its potential implication in pathological conditions characterized by aberrant extracellular matrix turnover. (

Biological Activity

Immobilized Human MMP-19 Protein at 2 μg/mL (100 μL/well) can bind Anti-MMP-19 antibody. The ED50 for this effect is 99.49 ng/mL.

  • Immobilized Human MMP-19 Protein at 2 μg/mL (100 μL/well) can bind Anti-MMP-19 antibody. The ED50 for this effect is 99.49 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99542-1 (L101-G256)

Gene ID

4327

Molecular Construction
N-term
MMP-19 (L101-G256)
Accession # Q99542-1
C-term
Protein Length

Partial

Synonyms
Matrix metalloproteinase-19; MMP-19; MMP-18; RASI
AA Sequence

LGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYG

Predicted Molecular Mass
17.4 kDa
분자량

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

MMP-19 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

MMP-19 Protein, Human

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
MMP-19 Protein, Human
Cat. No.:
HY-P75929A
수량:
MCE Japan Authorized Agent: