Copy Link Print Information

MMP-19 Protein, Human

Customer Review

Based on 1 Customer Validation

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MMP-19 Protein, Human
  • Experimental Validation Results for MMP-19 Protein, Human
  • MMP-19 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

Background

MMP-19 (Matrix Metalloproteinase-19) is an endopeptidase with a crucial role in degrading various components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (COMP), particularly during development, haemostasis, and pathological conditions such as arthritic diseases. Additionally, MMP-19 may contribute to neovascularization or angiogenesis, suggesting its involvement in processes associated with new blood vessel formation. The enzyme exhibits a broad substrate specificity, hydrolyzing key extracellular matrix proteins, such as collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin. MMP-19's ability to cleave diverse substrates underscores its significance in tissue remodeling and repair, as well as its potential implication in pathological conditions characterized by aberrant extracellular matrix turnover. (

Verified Bioactivity

Immobilized Human MMP-19 Protein at 2 μg/mL (100 μL/well) can bind Anti-MMP-19 antibody. The ED50 for this effect is 99.49 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human MMP-19 Protein at 2 μg/mL (100 μL/well) can bind Anti-MMP-19 antibody. The ED50 for this effect is 99.49 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q99542-1 (L101-G256)

  • Gene ID
    4327
  • Molecular Construction
    • N-term
    • MMP-19 (L101-G256)
      Accession # Q99542-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MMP19; CDNA FLJ60740, Moderately Similar To Matrix Metalloproteinase-19; Prev. MMP18; Matrix Metalloproteinase 19; RASI-1; MMP-19; Matrix Metalloproteinase RASI; MMP-18; Matrix Metalloproteinase-18; CODA; Matrix Metalloproteinase-19; RASI; Matrix Metallop

  • AA Sequence

    LGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYG

  • Predicted Molecular Mass

    17.4 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human MMP-19 Protein at 2 μg/mL (100 μL/well) can bind Anti-MMP-19 antibody. The ED50 for this effect is 99.49 ng/mL.

  • MMP-19 Protein, Human Product Image
    1/16
  • Experimental Validation Results for MMP-19 Protein, Human
  • Experimental Validation Results for MMP-19 Protein, Human
  • MMP-19 Protein, Human Product Image