MMP-2 Protein, Mouse (431a.a, HEK293, His)
MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (431a.a, HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (431a.a, HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
MMP-2 protein is a versatile ubiquitinous metalloproteinase with involvement in various functions, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Apart from its role in degrading extracellular matrix proteins, it also acts on nonmatrix proteins such as big endothelial 1 and beta-type CGRP, promoting vasoconstriction. Furthermore, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways and myocardial oxidative stress regulation by influencing GSK3beta activity. Additionally, MMP-2 is implicated in the formation of fibrovascular tissues and its C-terminal non-catalytic fragment, PEX, exhibits anti-angiogenic and anti-tumor properties while inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, MMP-2 serves as a ligand for integrin alpha-v/beta-3 on the surface of blood vessels.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P33434-1 (A30-T460)
-
Gene ID17390
-
Molecular Construction
-
N-term
-
MMP-2 (A30-T460)
Accession # P33434-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MMP2; Matrix Metallopeptidase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase); Prev. CLG4A; Collagenase Type IV-A; Prev. CLG4; Neutrophil Gelatinase; TBE-1; 72 KDa Gelatinase; MMP-2; Gelatinase A; 72 KDa Type IV Collagenase; MMP-II; Matrix M
-
AA Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPT
-
Predicted Molecular Mass
50 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
