MOG Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293, His, solution) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293, His, solution) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.
Background
MOG Protein plays a pivotal role in facilitating homophilic cell-cell adhesion, fostering essential connections between cells. As a minor yet integral component of the myelin sheath, MOG Protein is implicated in the potential completion and maintenance of this vital neural structure. Its influence extends beyond structural support, as it may also participate in mediating cell-cell communication. Notably, during microbial infections, MOG Protein serves as a receptor for the rubella virus, accentuating its multifaceted involvement in both physiological myelin function and pathological responses to viral challenges.
Verified Bioactivity
Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 0.9888 μg/mL, corresponding to a specific activity is 1.011×10^3 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q16653-1 (G30-G154)
-
Molecular Construction
-
N-term
-
MOG (G30-G154)
Accession # Q16653-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MOG; MOG Alpha-5; Myelin Oligodendrocyte Glycoprotein; MOG AluA; Myelin-Oligodendrocyte Glycoprotein; MOG AluB; BTNL11; MOGIG2; BTN6; NRCLP7; MOG Ig-AluB
-
AA Sequence
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
