Copy Link Print Information

MOG Protein, Human (HEK293, C-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293,C-His) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for MOG Protein, Human (HEK293, C-His)
  • Experimental Validation Results for MOG Protein, Human (HEK293, C-His)
  • MOG Protein, Human (HEK293, C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293,C-His) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MOG Protein plays a pivotal role in facilitating homophilic cell-cell adhesion, fostering essential connections between cells. As a minor yet integral component of the myelin sheath, MOG Protein is implicated in the potential completion and maintenance of this vital neural structure. Its influence extends beyond structural support, as it may also participate in mediating cell-cell communication. Notably, during microbial infections, MOG Protein serves as a receptor for the rubella virus, accentuating its multifaceted involvement in both physiological myelin function and pathological responses to viral challenges.

Verified Bioactivity

Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is <1.0 μg/mL, corresponding to a specific activity is approximately > 1.0×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 0.9783 μg/mL, corresponding to a specific activity is 1.022×103 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q16653-1 (G30-G154)

  • Gene ID
    4340
  • Molecular Construction
    • N-term
    • MOG (G30-G154)
      Accession # Q16653-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MOG; MOG Alpha-5; Myelin Oligodendrocyte Glycoprotein; MOG AluA; Myelin-Oligodendrocyte Glycoprotein; MOG AluB; BTNL11; MOGIG2; BTN6; NRCLP7; MOG Ig-AluB

  • AA Sequence

    GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

  • Molecular Weight

    Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 0.9783 μg/mL, corresponding to a specific activity is 1.022×103 units/mg.

  • MOG Protein, Human (HEK293, C-His) Product Image
    1/16
  • Experimental Validation Results for MOG Protein, Human (HEK293, C-His)
  • Experimental Validation Results for MOG Protein, Human (HEK293, C-His)
  • MOG Protein, Human (HEK293, C-His) Product Image