MOG Protein, Human (HEK293, C-His)

MOG proteins play a key role in homogeneous cell-to-cell adhesion, promoting important junctions. As a minor but integral component of myelin, it contributes to its underlying completion and maintenance. MOG Protein, Human (HEK293,C-His) is the recombinant human-derived MOG protein, expressed by HEK293 , with C-6*His labeled tag.

MOG Protein plays a pivotal role in facilitating homophilic cell-cell adhesion, fostering essential connections between cells. As a minor yet integral component of the myelin sheath, MOG Protein is implicated in the potential completion and maintenance of this vital neural structure. Its influence extends beyond structural support, as it may also participate in mediating cell-cell communication. Notably, during microbial infections, MOG Protein serves as a receptor for the rubella virus, accentuating its multifaceted involvement in both physiological myelin function and pathological responses to viral challenges.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is <1.0 μg/mL, corresponding to a specific activity is approximately > 1.0×10³ units/mg.

• 
  Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 0.9783 μg/mL, corresponding to a specific activity is 1.022×10³ units/mg.

Human

HEK293

C-6*His

Q16653-1 (G30-G154)

4340

Extracellular Domain

GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Approximately 19-25 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/a2780-cell.html  [Content Brief]