MOG Protein, Mouse (Biotinylated, HEK293, His-Avi)
MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived MOG protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived MOG protein, expressed by HEK293, with N-Avi labeled tag.
Background
MOG, a minor component of the myelin sheath, plays a potential role in the finalization and/or upkeep of the myelin sheath and contributes to cell-cell communication. Functioning as a homophilic cell adhesion molecule, MOG exhibits the capacity to mediate interactions between cells through homodimerization, highlighting its involvement in establishing cellular connections within the context of myelin-related processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q61885 (G29-T156)
-
Gene ID17441
-
Molecular Construction
-
N-term
-
Mog (G29-T156)
Accession # Q61885 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
MOG; MOG Alpha-5; Myelin Oligodendrocyte Glycoprotein; MOG AluA; Myelin-Oligodendrocyte Glycoprotein; MOG AluB; BTNL11; MOGIG2; BTN6; NRCLP7; MOG Ig-AluB
-
AA Sequence
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT
-
Predicted Molecular Mass
18.2 kDa
-
Molecular Weight
Approximately 21-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
