MSI2 Protein, Human (His, Strep)
MSI2 Protein, Human (His, Strep) is the recombinant human-derived MSI2, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MSI2 Protein, Human (His, Strep) is the recombinant human-derived MSI2, expressed by E. coli , with Strep, His labeled tag. ,
MSI2 is an RNA-binding protein that regulates the expression of target mRNAs at the translation level. It may play a role in the proliferation and maintenance of stem cells in the central nervous system (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q96DH6-1 (Q17-K111)
-
Gene ID124540
-
Protein Length
Partial
-
Synonyms
MSI2; CDNA FLJ52888, Highly Similar To RNA-Binding Protein Musashi Homolog 2; Musashi RNA Binding Protein 2; Musashi Homolog 2 (Drosophila); RNA-Binding Protein Musashi Homolog 2; Musashi Homolog 2; Musashi-2; MSI2H
-
AA Sequence
QHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKK
-
Predicted Molecular Mass
13.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
