MSI2 Protein, Human (His, Strep)
MSI2 Protein, Human (His, Strep) is the recombinant human-derived MSI2, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MSI2 Protein, Human (His, Strep) is the recombinant human-derived MSI2, expressed by E. coli , with Strep, His labeled tag. ,
Background
MSI2 is an RNA-binding protein that regulates the expression of target mRNAs at the translation level. It may play a role in the proliferation and maintenance of stem cells in the central nervous system (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q96DH6-1 (Q17-K111)
-
Gene ID124540
-
Protein Length
Full Length of RRM 1 Domain
-
Synonyms
MSI2; CDNA FLJ52888, Highly Similar To RNA-Binding Protein Musashi Homolog 2; Musashi RNA Binding Protein 2; Musashi Homolog 2 (Drosophila); RNA-Binding Protein Musashi Homolog 2; Musashi Homolog 2; Musashi-2; MSI2H
-
AA Sequence
QHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKK
-
Predicted Molecular Mass
13.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
