Copy Link Print Information

Mucin-1/MUC1 Protein, Human (HEK293, mFc)

Customer Review

Based on 1 Customer Validation

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Mucin-1/MUC1 Protein, Human (HEK293, mFc)
  • Experimental Validation Results for Mucin-1/MUC1 Protein, Human (HEK293, mFc)
  • Mucin-1/MUC1 Protein, Human (HEK293, mFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The Mucin-1/MUC1 protein exhibits diverse functional roles: the alpha subunit possesses cell adhesive properties and functions as both an adhesion and an anti-adhesion protein, potentially forming a protective layer on epithelial cells against bacterial and enzyme attacks. Simultaneously, the beta subunit, with its C-terminal domain, engages in cell signaling through phosphorylations and protein-protein interactions. Mucin-1/MUC1 modulates signaling in ERK, SRC, and NF-kappa-B pathways, influencing the Ras/MAPK pathway in activated T-cells. Additionally, it plays a role in promoting tumor progression, regulating TP53-mediated transcription, and determining cell fate in the genotoxic stress response. Notably, in conjunction with KLF4, Mucin-1/MUC1 binds to the PE21 promoter element of TP53, thereby repressing TP53 activity and contributing to the intricate network of cellular functions.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human MUC1 is present at 1 μg/mL, can bind Human MUC1 Antibody. The ED50 for this effect is 5.59 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human MUC1 is present at 1 μg/mL, can bind Human MUC1 Antibody. The ED50 for this effect is 5.59 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mFc
  • Accession

    P15941-1 (S1098-G1158)

  • Gene ID
    4582  [NCBI]
  • Molecular Construction
    • N-term
    • Mucin-1 (S1098-G1158)
      Accession # P15941-1
    • mFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MUC1; Mucin Short Variant E1; Prev. PUM; MUC1 Isoform SV7-LSP; Prev. MCKD1; MUC1 Isoform J18; KL-6; MUC1 Isoform J16; PEM; MUC1 Isoform J15; EMA; MUC1 Isoform J24; ADMCKD1; MUC1 Isoform T12; Mucin-1; MUC1 Isoform T13; ADMCKD; MUC1 Isoform M11; Ca15-3; MUC

  • AA Sequence

    SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

  • Molecular Weight

    Approximately 43-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human MUC1 is present at 1 μg/mL, can bind Human MUC1 Antibody. The ED50 for this effect is 5.59 ng/mL.

  • Mucin-1/MUC1 Protein, Human (HEK293, mFc) Product Image
    1/16
  • Experimental Validation Results for Mucin-1/MUC1 Protein, Human (HEK293, mFc)
  • Experimental Validation Results for Mucin-1/MUC1 Protein, Human (HEK293, mFc)
  • Mucin-1/MUC1 Protein, Human (HEK293, mFc) Product Image