¹⁵N-Labeled Amyloid Precursor/Beta-APP40 Protein, Human
This protein is prone to aggregation after reconstitution, immediate use and smaller package sizes are recommended.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
This protein is prone to aggregation after reconstitution, immediate use and smaller package sizes are recommended.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05067-1 (D672-V711)
-
Gene ID351
-
Molecular Construction
-
N-term
-
Beta-APP40 (D672-V711)
Accession # P05067-1 -
C-term
-
-
Protein Length
Full Length of APP40 Chain
-
Synonyms
¹⁵N-Beta-Amyloid Peptide(1-40); ¹⁵N-Aβ(1-40); ¹⁵N-Amyloid β Protein Fragment(1-40); ¹⁵N-Amyloid β-Peptide(1-40)(human); ¹⁵N-β-amyloid(1-40); APP; PreA4; Prev. AD1; CVAP; Alzheimer Disease Amyloid A4 Protein Homolog; Beta-Amyloid Precursor Protein; Amyloid-Beta Precursor Protein; Testicular Tissue Protein Li 2; Amyloid Precursor Protein; Beta-Amyloid Peptide(1-40); Alpha-SAPP; Beta-Amyloid Peptide(1-42); ABPP; Alternative Protein APP; Amyloid Beta (A4) Precursor Protein; Beta-Amyloid Peptide; Amyloid-Beta (A4) Precursor Protein; Amyloid Beta Protein; Alzheimer Disease Amyloid Protein; Alzheimer Disease; Cerebral Vascular Amyloid Peptide; CTFgamma; Amyloid Beta A4 Protein; ABETA; Amyloid-Beta A4 Protein; AAA; Peptidase Nexin-II; PN2; Protease Nexin-II; A4; PN-II; Amyloid Beta Precursor Protein; APPI
-
AA Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. Due to its tendency to aggregate after reconstitution, immediate use and smaller package sizes are recommended.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
