¹⁵N-Labeled Cystatin C/CST3 Protein, Human (His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P01034 (S27-A146)
-
Gene ID1471
-
Molecular Construction
-
N-term
-
6*His
-
CST3 (S27-A146)
Accession # P01034 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
¹⁵N-γ-trace; ¹⁵N-post-γ-globulin; ¹⁵N-Cys-C; ¹⁵N-Gamma trace protein; ¹⁵N-Post-gamma globulin; ¹⁵N-Neuroendocrine basic polypeptide; CST3; Cystatin C (Amyloid Angiopathy And Cerebral Hemorrhage); Cystatin C; BA218C14.4 (Cystatin C); Epididymis Secretory Protein Li 2; Cystatin 3; Neuroendocrine Basic Polypeptide; Cystatin-3; Post-Gamma-Globulin; HEL-S-2; Gamma-Trace; ADLDWA; Cystatin-C; ARMD11
-
AA Sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
