¹⁵N-Labeled NPPB Protein, Human (76a.a, His)
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P16860 (H27-R102)
-
Gene ID4879
-
Molecular Construction
-
N-term
-
6*His
-
NPPB (H27-R102)
Accession # P16860 -
C-term
-
-
Protein Length
Full Length of NT-proBNP Peptide
-
Synonyms
¹⁵N-NT-proBNP; ¹⁵N-N-terminal pro-B-type natriuretic peptide; ¹⁵N-ProBNP N-terminal fragment; NPPB; PreproBNP; Natriuretic Peptide B; Iso-ANP; Brain Natriuretic Factor Prohormone; ProBNP; Natriuretic Peptide Precursor B; Brain Type Natriuretic Peptide; Gamma-Brain Natriuretic Peptide; Natriuretic Protein; Natriuretic Peptides B; BNP
-
AA Sequence
HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
