NAA10/ARD1 Protein, Human (sf9)

Customer Review

Based on 1 Customer Validation

The NAA10/ARD1 protein is the catalytic subunit of the N-terminal acetyltransferase complex and has alpha acetyltransferase activity. NAA10/ARD1 affects vascular, hematopoietic, and neuronal growth and development. NAA10/ARD1 inhibits tumor cell migration, inhibits mTOR activity and cancer development. NAA10/ARD1 Protein, Human (sf9) is the recombinant human-derived NAA10/ARD1 protein, expressed by Sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NAA10/ARD1 protein is the catalytic subunit of the N-terminal acetyltransferase complex and has alpha acetyltransferase activity. NAA10/ARD1 affects vascular, hematopoietic, and neuronal growth and development. NAA10/ARD1 inhibits tumor cell migration, inhibits mTOR activity and cancer development. NAA10/ARD1 Protein, Human (sf9) is the recombinant human-derived NAA10/ARD1 protein, expressed by Sf9 insect cells , with tag free.

Background

NAA10, the catalytic subunit of N-terminal acetyltransferase complexes, exhibits alpha (N-terminal) acetyltransferase activity, playing a crucial role in acetylating amino termini lacking initiator methionine. This activity holds significance in processes related to vascular, hematopoietic, and neuronal growth and development. In conjunction with NAA15, NAA10 displays epsilon (internal) acetyltransferase activity towards HIF1A, leading to its degradation and impacting cellular responses. Notably, NAA10 has diverse roles, repressing MYLK kinase activity through acetylation to inhibit tumor cell migration and stabilizing TSC2, thereby suppressing mTOR activity and impeding cancer development. Furthermore, NAA10 acetylates HSPA1A and HSPA1B at 'Lys-77,' enhancing their chaperone activity and promoting preferential binding to co-chaperone HOPX. Additional substrates include HIST1H4A, indicating a broad impact on cellular processes. Intriguingly, NAA10 acts as a negative regulator of sister chromatid cohesion during mitosis, underscoring its multifunctional role in cellular homeostasis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • NAA10 (M1-S235)
      Accession # P41227
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    NAA10; N(Alpha)-Acetyltransferase 10, NatA Catalytic Subunit; Prev. ARD1A; ARD1 Homolog A, N-Acetyltransferase (S. Cerevisiae); Prev. ARD1; ARD1 Homolog, N-Acetyltransferase (S. Cerevisiae); TE2; N-Acetyltransferase ARD1, Human Homolog Of; DXS707; ARD1 Ho

  • AA Sequence

    MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

  • Predicted Molecular Mass

    26.5 kDa

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00