TFAM Protein, Mouse (His, Myc)
Based on 1 publication(s) in Google Scholar
TFAM proteins are critical in the regulation of mitochondrial transcription, bind to light chain promoters and are essential for basal mitochondrial DNA transcription.In the initiation complex of TFB2M and POLRMT, TFAM recruits POLRMT, and TFB2M induces structural changes in POLRMT, promoting promoter opening.TFAM Protein, Mouse (His, Myc) is the recombinant mouse-derived TFAM protein, expressed by E.coli , with N-10*His, C-Myc labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TFAM proteins are critical in the regulation of mitochondrial transcription, bind to light chain promoters and are essential for basal mitochondrial DNA transcription.In the initiation complex of TFB2M and POLRMT, TFAM recruits POLRMT, and TFB2M induces structural changes in POLRMT, promoting promoter opening.TFAM Protein, Mouse (His, Myc) is the recombinant mouse-derived TFAM protein, expressed by E.coli , with N-10*His, C-Myc labeled tag.
Background
The TFAM protein plays a pivotal role in mitochondrial transcription regulation by binding to the mitochondrial light strand promoter. As a crucial component of the mitochondrial transcription initiation complex, which includes TFB2M and POLRMT, TFAM is essential for the basal transcription of mitochondrial DNA. Within this complex, TFAM recruits POLRMT to a specific promoter, while TFB2M induces structural changes in POLRMT, facilitating promoter opening and trapping of the DNA non-template strand. TFAM is also indispensable for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It further promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. With the ability to unwind DNA and bend the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes, TFAM plays a critical role in maintaining normal levels of mitochondrial DNA. Moreover, it may contribute to organizing and compacting mitochondrial DNA and potentially function in transcriptional activation or have a structural role in the compaction of nuclear DNA during spermatogenesis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Sci Immunol
PTMA safeguards mitochondrial integrity to sustain metabolic function and antitumor activity of CD8 T cells. [Abstract]2026 Jan 23;11(115):eadz7275. PMID: 41544148
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P40630 (S43-H243)
-
Gene ID21780
-
Molecular Construction
-
N-term
-
10*His
-
TFAM (S43-H243)
Accession # P40630 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFAM; Alternative Protein TFAM; Prev. TCF6L2; MTDPS15; Prev. TCF6; TCF6L1; Mitochondrial Transcription Factor 1; TCF6L3; Transcription Factor 6; MTTF1; Transcription Factor 6-Like 2 (Mitochondrial Transcription Factor); MTTFA; Mitochondrial Transcription
-
AA Sequence
SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH
-
Predicted Molecular Mass
30.9 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)