TFAM Protein, Mouse (His, Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

TFAM proteins are critical in the regulation of mitochondrial transcription, bind to light chain promoters and are essential for basal mitochondrial DNA transcription.In the initiation complex of TFB2M and POLRMT, TFAM recruits POLRMT, and TFB2M induces structural changes in POLRMT, promoting promoter opening.TFAM Protein, Mouse (His, Myc) is the recombinant mouse-derived TFAM protein, expressed by E.coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TFAM proteins are critical in the regulation of mitochondrial transcription, bind to light chain promoters and are essential for basal mitochondrial DNA transcription.In the initiation complex of TFB2M and POLRMT, TFAM recruits POLRMT, and TFB2M induces structural changes in POLRMT, promoting promoter opening.TFAM Protein, Mouse (His, Myc) is the recombinant mouse-derived TFAM protein, expressed by E.coli , with N-10*His, C-Myc labeled tag.

Background

The TFAM protein plays a pivotal role in mitochondrial transcription regulation by binding to the mitochondrial light strand promoter. As a crucial component of the mitochondrial transcription initiation complex, which includes TFB2M and POLRMT, TFAM is essential for the basal transcription of mitochondrial DNA. Within this complex, TFAM recruits POLRMT to a specific promoter, while TFB2M induces structural changes in POLRMT, facilitating promoter opening and trapping of the DNA non-template strand. TFAM is also indispensable for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It further promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. With the ability to unwind DNA and bend the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes, TFAM plays a critical role in maintaining normal levels of mitochondrial DNA. Moreover, it may contribute to organizing and compacting mitochondrial DNA and potentially function in transcriptional activation or have a structural role in the compaction of nuclear DNA during spermatogenesis.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • TFAM (S43-H243)
      Accession # P40630
    • Myc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TFAM; Alternative Protein TFAM; Prev. TCF6L2; MTDPS15; Prev. TCF6; TCF6L1; Mitochondrial Transcription Factor 1; TCF6L3; Transcription Factor 6; MTTF1; Transcription Factor 6-Like 2 (Mitochondrial Transcription Factor); MTTFA; Mitochondrial Transcription

  • AA Sequence

    SSMGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH

  • Predicted Molecular Mass

    30.9 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00