SARS-CoV-2 NCP N Protein (101a.a)
The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.
Background
The SARS-CoV-2 Nucleocapsid Protein assumes a pivotal role in virion assembly, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP) and establishing crucial interactions with the viral genome and membrane protein M. Beyond its structural functions, this protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Notably, it exhibits an additional role in modulating host chemokine function, a mechanism that may favor viral replication and transmission. The Nucleocapsid Protein achieves this modulation by being secreted into the extracellular space, where it competes with host chemokines for binding to host glycosaminoglycans (GAG), thus potentially disrupting host defense mechanisms and supporting the viral life cycle.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag Tag Free
-
Accession
P0DTC9 (N269-K369)
-
Gene ID43740575
-
Protein Length
Partial
-
Synonyms
Nucleoprotein; Nucleocapsid protein; NC; Protein N; N; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; N; Ribonucleoprotein; RNA-binding; Viral nucleoprotein
-
AA Sequence
NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPK
-
Predicted Molecular Mass
11.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
