1. Recombinant Proteins
  2. Viral Proteins Others
  3. SARS-CoV-2 NCP N Protein (101a.a)

The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.

Background

The SARS-CoV-2 Nucleocapsid Protein assumes a pivotal role in virion assembly, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP) and establishing crucial interactions with the viral genome and membrane protein M. Beyond its structural functions, this protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Notably, it exhibits an additional role in modulating host chemokine function, a mechanism that may favor viral replication and transmission. The Nucleocapsid Protein achieves this modulation by being secreted into the extracellular space, where it competes with host chemokines for binding to host glycosaminoglycans (GAG), thus potentially disrupting host defense mechanisms and supporting the viral life cycle.

Species

Virus

Source

E. coli

Tag

Tag Free

Accession

P0DTC9 (N269-K369)

Gene ID

43740575

Protein Length

Partial

Synonyms
Nucleoprotein; Nucleocapsid protein; NC; Protein N; N; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; N; Ribonucleoprotein; RNA-binding; Viral nucleoprotein
AA Sequence

NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPK

Predicted Molecular Mass
11.4 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SARS-CoV-2 NCP N Protein (101a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SARS-CoV-2 NCP N Protein (101a.a)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 NCP N Protein (101a.a)
Cat. No.:
HY-P703529
Quantity:
MCE Japan Authorized Agent: