SARS-CoV-2 NCP N Protein (101a.a)

The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The SARS-CoV-2 nucleocapsid protein plays a crucial role in assembling the virion, forming the helical ribonucleocapsid (RNP), and interacting with the viral genome and membrane protein M. In addition to its structural function, it also enhances subgenomic viral RNA transcription and overall replication. NCP N Protein, SARS-CoV-2 (N269-K369) is the recombinant virus-derived NCP N, expressed by E. coli, with tag-free.

Background

The SARS-CoV-2 Nucleocapsid Protein assumes a pivotal role in virion assembly, orchestrating the packaging of the positive-strand viral genome RNA into a helical ribonucleocapsid (RNP) and establishing crucial interactions with the viral genome and membrane protein M. Beyond its structural functions, this protein significantly contributes to the efficiency of subgenomic viral RNA transcription and overall viral replication. Notably, it exhibits an additional role in modulating host chemokine function, a mechanism that may favor viral replication and transmission. The Nucleocapsid Protein achieves this modulation by being secreted into the extracellular space, where it competes with host chemokines for binding to host glycosaminoglycans (GAG), thus potentially disrupting host defense mechanisms and supporting the viral life cycle.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    Nucleoprotein; Nucleocapsid protein; NC; Protein N; N; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; N; Ribonucleoprotein; RNA-binding; Viral nucleoprotein

  • AA Sequence

    NVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPK

  • Predicted Molecular Mass

    11.4 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00