NEK2 Protein, Human (T175A)
The NEK2 protein is a key kinase that coordinates important events in cell division and chromatin dynamics. In mitotic cells, it critically controls centrosome separation and bipolar spindle formation by phosphorylating CROCC, CEP250 and NINL. NEK2 Protein, Human is the recombinant human-derived NEK2 protein, expressed by E. coli , with tag free, and T175A mutation.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The NEK2 protein is a key kinase that coordinates important events in cell division and chromatin dynamics. In mitotic cells, it critically controls centrosome separation and bipolar spindle formation by phosphorylating CROCC, CEP250 and NINL. NEK2 Protein, Human is the recombinant human-derived NEK2 protein, expressed by E. coli , with tag free, and T175A mutation.
NEK2 protein emerges as a pivotal kinase, intricately involved in orchestrating essential events in cell division and chromatin dynamics. In mitotic cells, NEK2 plays a crucial role in controlling centrosome separation and bipolar spindle formation by phosphorylating key centrosomal proteins, including CROCC, CEP250, and NINL, leading to their displacement from centrosomes. NEK2 also regulates kinetochore microtubule attachment stability through the phosphorylation of NDC80 and participates in the mitotic checkpoint by phosphorylating CDC20 and MAD2L1. Moreover, NEK2 actively contributes to chromatin condensation during the first meiotic division through the phosphorylation of HMGA2. Its impact extends to the localization of MAD2L1 to the kinetochore and MAPK1 and NPM1 to the centrosome. NEK2-mediated phosphorylation of CEP68 and CCDC102B further modulates centrosome dynamics, influencing their dissociation and separation during cell division. Additionally, NEK2 phosphorylates and activates NEK11 in G1/S-arrested cells, highlighting its comprehensive role in coordinating various cellular processes critical for accurate cell division.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P51955-1 (M1-I271, T175A)
-
Gene ID4751
-
Molecular Construction
-
N-term
-
NEK2 (M1-I271, T175A)
Accession # P51955-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NEK2; Protein Phosphatase 1, Regulatory Subunit 111; NIMA Related Kinase 2; Never In Mitosis A-Related Kinase 2; NEK2A; NimA-Related Protein Kinase 2; NLK1; NimA-Like Protein Kinase 1; Serine/Threonine-Protein Kinase Nek2; HsPK 21; PPP1R111; HSPK 21; RP67
-
AA Sequence
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
