1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Other Kinases
  4. NEK
  5. NEK2
  6. NEK2 Protein, Human (T175A)

The NEK2 protein is a key kinase that coordinates important events in cell division and chromatin dynamics. In mitotic cells, it critically controls centrosome separation and bipolar spindle formation by phosphorylating CROCC, CEP250 and NINL. NEK2 Protein, Human is the recombinant human-derived NEK2 protein, expressed by E. coli , with tag free, and T175A mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NEK2 protein is a key kinase that coordinates important events in cell division and chromatin dynamics. In mitotic cells, it critically controls centrosome separation and bipolar spindle formation by phosphorylating CROCC, CEP250 and NINL. NEK2 Protein, Human is the recombinant human-derived NEK2 protein, expressed by E. coli , with tag free, and T175A mutation.

Background

NEK2 protein emerges as a pivotal kinase, intricately involved in orchestrating essential events in cell division and chromatin dynamics. In mitotic cells, NEK2 plays a crucial role in controlling centrosome separation and bipolar spindle formation by phosphorylating key centrosomal proteins, including CROCC, CEP250, and NINL, leading to their displacement from centrosomes. NEK2 also regulates kinetochore microtubule attachment stability through the phosphorylation of NDC80 and participates in the mitotic checkpoint by phosphorylating CDC20 and MAD2L1. Moreover, NEK2 actively contributes to chromatin condensation during the first meiotic division through the phosphorylation of HMGA2. Its impact extends to the localization of MAD2L1 to the kinetochore and MAPK1 and NPM1 to the centrosome. NEK2-mediated phosphorylation of CEP68 and CCDC102B further modulates centrosome dynamics, influencing their dissociation and separation during cell division. Additionally, NEK2 phosphorylates and activates NEK11 in G1/S-arrested cells, highlighting its comprehensive role in coordinating various cellular processes critical for accurate cell division.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P51955-1 (M1-I271, T175A)

Gene ID

4751

Molecular Construction
N-term
NEK2 (M1-I271, T175A)
Accession # P51955-1
C-term
Protein Length

Partial

Synonyms
NEK2; Serine/threonine-protein kinase Nek2; HSPK 21; Never in mitosis A-related kinase 2; NimA-related protein kinase 2; NimA-like protein kinase 1
AA Sequence

MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLI

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NEK2 Protein, Human (T175A)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEK2 Protein, Human (T175A)
Cat. No.:
HY-P701822
Quantity:
MCE Japan Authorized Agent: