Neuroserpin Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Neuroserpin is a serine protease inhibitor that significantly inhibits plasminogen activator and plasmin without affecting thrombin.In addition to their role in protease inhibition, neuroserine proteases contribute to synaptic plasticity, affecting synaptic connections in the adult nervous system.Neuroserpin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Neuroserpin protein, expressed by HEK293 , with C-His labeled tag.
Background
Neuroserpin, a serine protease inhibitor, plays a crucial role in inhibiting plasminogen activators and plasmin, with no inhibitory effect on thrombin. Beyond its role as a protease inhibitor, it is implicated in the formation or reorganization of synaptic connections, contributing to synaptic plasticity in the adult nervous system. Additionally, there is a suggested protective role for neuroserpin in safeguarding neurons from cell damage mediated by tissue-type plasminogen activator. These functions underscore the significance of neuroserpin in regulating proteolytic activities and maintaining neuronal integrity in the intricate network of synaptic processes.
Verified Bioactivity
Measured in a cell proliferation assay using rat C6 cells. The ED50 for this effect is 0.894 μg/mL, corresponding to a specific activity is 1.118×10[3] units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
O35684 (T17-L410)
-
Molecular Construction
-
N-term
-
Neuroserpin (T17-L410)
Accession # O35684 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SERPINI1; PI-12; Prev. PI12; Serpin Peptidase Inhibitor Clade I Member 1 Isoform 2; Neuroserpin; Serpin Peptidase Inhibitor Clade I Member 1 Isoform 1; Serine (Or Cysteine) Proteinase Inhibitor, Clade I (Neuroserpin), Member 1; Serpin Peptidase Inhibitor
-
AA Sequence
TGATFPDETITEWSVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKSCIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPETMNTSGHDFEEL
-
Molecular Weight
Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
