Neurotoxin Type A Light Chain Protein, Botulinum (P. pastoris, His)

Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by disrupting the release of acetylcholine in the nervous system. This precursor relies on polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type A Light Chain Protein, Botulinum (P. pastoris, His) is the recombinant Neurotoxin Type A Light Chain protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Neurotoxin light chain protein is a component of botulinum toxin that induces flaccid paralysis by disrupting the release of acetylcholine in the nervous system. This precursor relies on polysialylated gangliosides and membrane-anchored proteins as coreceptors. Neurotoxin Type A Light Chain Protein, Botulinum (P. pastoris, His) is the recombinant Neurotoxin Type A Light Chain protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Neurotoxin Type A Light Chain Protein, a component of botulinum toxin, induces flaccid paralysis by disrupting neurotransmitter (acetylcholine) release from presynaptic membranes in the skeletal and autonomic nervous systems of eukaryotic hosts, often leading to respiratory or cardiac failure. The precursor of botulinum neurotoxin A2, it relies on two coreceptors—complex polysialylated gangliosides on neural tissue and specific membrane-anchored proteins in synaptic vesicles. Receptor proteins become accessible during neurotransmitter release, initiating binding with the toxin's heavy chain (HC). Following endocytic uptake and a pH-dependent structural rearrangement, the HC's N-terminus forms pores, enabling the translocation of the light chain (LC) into the cytosol. Once in the cytosol, the disulfide bond between the subunits is reduced, allowing LC to cleave its target protein, SNAP25, preventing synaptic vesicle fusion with the cytoplasmic membrane and thereby halting neurotransmitter release. The proteolytic activity of LC, specifically hydrolyzing the 197-Gln-|-Arg-198 bond in SNAP25, is crucial for its inhibitory effect on neurotransmission.

Technical Parameters

  • Species Others
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • BoNT/A (M1-P436)
      Accession # Q45894
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Botulinum neurotoxin type A2; BoNT/A; BoNTA2; Bontoxilysin-A; BOTOX; Botulinum neurotoxin A2 light chain (LC); EC:3.4.24.69; Botulinum neurotoxin A2 heavy chain (HC); botA; atx; bna; bonT; bont/a2; CLM_0897

  • AA Sequence

    MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHDVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAEHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAKSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVINRKTYLNFDKAVFRINIVPDENYTIKDGFNLKGANLSTNFNGQNTEINSRNFTRLKNFTGLFEFYKLLCVRGIIP

  • Predicted Molecular Mass

    52 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00