Glycoprotein G, Nipah virus (HEK293, His)
Glycoprotein G/gG Protein, present in herpesviruses, serves various functions. It binds to host immunoglobulins, modulating their activity and evading the immune system. Understanding the role of Glycoprotein G/gG Protein is crucial for studying herpesvirus infections and developing effective antiviral treatments. Glycoprotein G, Nipah virus (HEK293, His) is the recombinant virus-derived Glycoprotein G protein, expressed by HEK293, with N-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Glycoprotein G/gG Protein, present in herpesviruses, serves various functions. It binds to host immunoglobulins, modulating their activity and evading the immune system. Understanding the role of Glycoprotein G/gG Protein is crucial for studying herpesvirus infections and developing effective antiviral treatments. Glycoprotein G, Nipah virus (HEK293, His) is the recombinant virus-derived Glycoprotein G protein, expressed by HEK293, with N-His labeled tag.
Background
Glycoprotein G (gG) protein facilitates virion attachment to the target cell by interacting with host ephrinB2 (EFNB2) or ephrin B3 (EFNB3). This interaction leads to virion internalization, primarily through clathrin-mediated endocytosis. The protein is involved in binding with both host EFNB2 and EFNB3 to facilitate the attachment process.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag N-His
-
Accession
Q9IH62-1 (Q71-T602)
-
Gene ID920955
-
Molecular Construction
-
N-term
-
His
-
G (Q71-T602)
Accession # Q9IH62-1 -
C-term
-
-
Protein Length
Full Length of Virion surface Domain
-
Synonyms
Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG; Mature secreted glycoprotein G; Mature secreted glycoprotein G; Mature secreted glycoprotein G; G
-
AA Sequence
QNYTRSTDNQAVIKDALQGIQQQIKGLADKIGTEIGPKVSLIDTSSTITIPANIGLLGSKISQSTASINENVNEKCKFTLPPLKIHECNISCPNPLPFREYRPQTEGVSNLVGLPNNICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCT
-
Predicted Molecular Mass
61.2 kDa
-
Molecular Weight
Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
