NKG2C/CD159c Protein, Cynomolgus (HEK293, His)
The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2C/CD159c protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2C/CD159c protein, expressed by HEK293 , with N-His labeled tag.
Background
NKG2C/CD159c Protein, an immune activating receptor, plays a pivotal role in self-nonself discrimination. Teaming up with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules. This interaction likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and is implicated in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infection. Upon binding to HLA-E-peptide complexes, NKG2C/CD159c transmits intracellular signals through the adapter protein TYROBP/DAP12, initiating the phosphorylation of proximal signaling molecules and subsequent cell activation. Forming a heterodimer with KLRD1 through disulfide linkage, the KLRD1-KLRC2 receptor complex, in association with TYROBP homodimers, is crucial for its cell surface expression. Additionally, this receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia. The multifaceted interactions and functions of NKG2C/CD159c underscore its essential role in immune responses and self-tolerance mechanisms.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-8*His
-
Accession
Q68VD0 (I94-L231)
-
Gene ID/
-
Molecular Construction
-
N-term
-
8*His
-
NKG2C (I94-L231)
Accession # Q68VD0 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
KLRC2; NK Cell Receptor C; Killer Cell Lectin Like Receptor C2; NKG2-C; NKG2-C Type II Integral Membrane Protein; CD159c; NKG2C; Killer Cell Lectin-Like Receptor Subfamily C, Member 2; CD159 Antigen-Like Family Member C; Natural Killer Cell Receptor G2-C;
-
AA Sequence
IPLLEQSNSSPNTRTQKVRHCGHCPEEWITYSNSCYYFGKEKRTWAESLLACASKNSSLLSIDNEEEMKFLTAILPSSWIGVFRDSSHHPWVTINGLTFKHEIKESDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)