1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. NKG2C/CD159c
  5. NKG2C/CD159c Protein, Cynomolgus (HEK293, His)

NKG2C/CD159c Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P77809
Handling Instructions Technical Support

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2C/CD159c protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The NKG2C/CD159c protein is an immune-activating receptor that plays a critical role in self-non-self discrimination. It cooperates with KLRD1 to recognize non-classical MHC class Ib HLA-E loaded with HLA-G peptides, affecting adaptive NK cell function and maternal-fetal tolerance. NKG2C/CD159c Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2C/CD159c protein, expressed by HEK293 , with N-His labeled tag.

Background

NKG2C/CD159c Protein, an immune activating receptor, plays a pivotal role in self-nonself discrimination. Teaming up with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility (MHC) class Ib HLA-E loaded with signal sequence-derived peptides from non-classical MHC class Ib HLA-G molecules. This interaction likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and is implicated in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infection. Upon binding to HLA-E-peptide complexes, NKG2C/CD159c transmits intracellular signals through the adapter protein TYROBP/DAP12, initiating the phosphorylation of proximal signaling molecules and subsequent cell activation. Forming a heterodimer with KLRD1 through disulfide linkage, the KLRD1-KLRC2 receptor complex, in association with TYROBP homodimers, is crucial for its cell surface expression. Additionally, this receptor complex can bind with low affinity to HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia. The multifaceted interactions and functions of NKG2C/CD159c underscore its essential role in immune responses and self-tolerance mechanisms.

Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

Q68VD0 (I94-L231)

Gene ID

/

Molecular Construction
N-term
8*His
NKG2C (I94-L231)
Accession # Q68VD0
C-term
Protein Length

Cytoplasmic Domain

Synonyms
CD159c; KLRC2; NKG2C; NK cell receptor C
AA Sequence

IPLLEQSNSSPNTRTQKVRHCGHCPEEWITYSNSCYYFGKEKRTWAESLLACASKNSSLLSIDNEEEMKFLTAILPSSWIGVFRDSSHHPWVTINGLTFKHEIKESDNAEHNCAMLHARGLKSDRCGSSKIYHCKHKL

Predicted Molecular Mass
16.9 kDa
Molecular Weight

Approximately 25-30 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

NKG2C/CD159c Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKG2C/CD159c Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2C/CD159c Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P77809
Quantity:
MCE Japan Authorized Agent: