NKG2D/CD314 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

The NKG2D/CD314 protein serves as an important activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells, activates NK cells and serves as a costimulatory receptor for CD8(+) T cell-mediated adaptive responses, thereby enhancing T cell activation. NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NKG2D/CD314 protein serves as an important activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells, activates NK cells and serves as a costimulatory receptor for CD8(+) T cell-mediated adaptive responses, thereby enhancing T cell activation. NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

NKG2D/CD314 protein operates as an activating and costimulatory receptor crucial for immunosurveillance, binding to diverse stress-inducible ligands presented on autologous tumor cells and virus-infected cells. It plays a dual role in innate immune responses, stimulating both activating killer (NK) cells and acting as a costimulatory receptor for T-cell receptors (TCR) in CD8(+) T-cell-mediated adaptive immune responses, enhancing T-cell activation. The receptor facilitates perforin-mediated elimination of ligand-expressing tumor cells and triggers signaling cascades involving calcium influx, ultimately leading to TNF-alpha expression. Additionally, NKG2D/CD314 participates in NK cell-mediated bone marrow graft rejection and may regulate the differentiation and survival of NK cells. Its ligand-binding capacity extends to various subfamilies of MHC class I-related glycoproteins. The protein forms homodimers through disulfide linkage and heterohexamers with HCST/DAP10 subunits, a crucial interaction for NK cell surface expression and cytotoxicity induction. Furthermore, it can establish disulfide-bonded heterodimers with CD94 and interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • NKG2D (F78-V216)
      Accession # P61252
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Kille

  • AA Sequence

    FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

  • Predicted Molecular Mass

    16.9 kDa

  • Molecular Weight

    Approximately 22-35 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00