1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins
  4. CD314/NKG2D
  5. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)

NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)

Cat. No.: HY-P75940
Handling Instructions Technical Support

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells and triggers the innate immune response of NK cells. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells and triggers the innate immune response of NK cells. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

NKG2D/CD314 Protein functions as an activating and costimulatory receptor crucial for immunosurveillance, binding to various stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. The signaling pathway involves calcium influx, resulting in TNF-alpha expression. Additionally, NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and can also create a heterohexamer with HCST/DAP10, essential for NK cell surface expression and induction of NK cell-mediated cytotoxicity. Furthermore, NKG2D interacts with CEACAM1, recruiting PTPN6, which dephosphorylates VAV1. This multifaceted interaction network underscores the critical role of NKG2D in immune responses and surveillance.

Species

Rhesus Macaque

Source

Sf9 insect cells

Tag

N-His

Accession

Q9MZJ7 (F78-V216)

Gene ID
Molecular Construction
N-term
His
NKG2D (F78-V216)
Accession # Q9MZJ7
C-term
Protein Length

Partial

Synonyms
NKG2-D type II integral membrane protein; NK cell receptor D; KLRK1
AA Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

Predicted Molecular Mass
18.3 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)
Cat. No.:
HY-P75940
Quantity:
MCE Japan Authorized Agent: