NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells and triggers the innate immune response of NK cells. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Rhesus Macaque
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells and triggers the innate immune response of NK cells. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
NKG2D/CD314 Protein functions as an activating and costimulatory receptor crucial for immunosurveillance, binding to various stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. The signaling pathway involves calcium influx, resulting in TNF-alpha expression. Additionally, NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and can also create a heterohexamer with HCST/DAP10, essential for NK cell surface expression and induction of NK cell-mediated cytotoxicity. Furthermore, NKG2D interacts with CEACAM1, recruiting PTPN6, which dephosphorylates VAV1. This multifaceted interaction network underscores the critical role of NKG2D in immune responses and surveillance.
Technical Parameters
-
Species Rhesus Macaque
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q9MZJ7 (F78-V216)
-
Molecular Construction
-
N-term
-
His
-
NKG2D (F78-V216)
Accession # Q9MZJ7 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
KLRK1; CD314; Prev. D12S2489E; Killer Cell Lectin-Like Receptor Subfamily K, Member 1; NKG2D; NKG2-D-Activating NK Receptor; NKG2-D Type II Integral Membrane Protein; DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence; NK Cell Receptor D; Kille
-
AA Sequence
FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV
-
Predicted Molecular Mass
18.3 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)