NKG2D/CD314 Protein, Rhesus Macaque (sf9, His)

The NKG2D/CD314 protein serves as a key activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells and triggers the innate immune response of NK cells. NKG2D/CD314 Protein, Rhesus Macaque (sf9, His) is the recombinant Rhesus Macaque-derived NKG2D/CD314 protein, expressed by Sf9 insect cells , with N-His labeled tag.

NKG2D/CD314 Protein functions as an activating and costimulatory receptor crucial for immunosurveillance, binding to various stress-inducible ligands on autologous tumor cells and virus-infected cells. This engagement triggers stimulatory and costimulatory innate immune responses in activated killer (NK) cells, leading to cytotoxic activity. In CD8(+) T-cell-mediated adaptive immune responses, NKG2D acts as a costimulatory receptor for the T-cell receptor (TCR), amplifying T-cell activation and stimulating perforin-mediated elimination of ligand-expressing tumor cells. The signaling pathway involves calcium influx, resulting in TNF-alpha expression. Additionally, NKG2D participates in NK cell-mediated bone marrow graft rejection and may regulate NK cell differentiation and survival. The protein forms a homodimer through disulfide linkage and can also create a heterohexamer with HCST/DAP10, essential for NK cell surface expression and induction of NK cell-mediated cytotoxicity. Furthermore, NKG2D interacts with CEACAM1, recruiting PTPN6, which dephosphorylates VAV1. This multifaceted interaction network underscores the critical role of NKG2D in immune responses and surveillance.

Rhesus Macaque

Sf9 insect cells

N-His

Q9MZJ7 (F78-V216)

574240  [NCBI]

Partial

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.