NRAS Protein, Human (His, solution)
Based on 1 publication(s) in Google Scholar
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
NRAS protein is a member of the Ras family that binds GDP/GTP and has intrinsic GTPase activity. This property enables NRAS to actively regulate cellular processes by cycling between a GDP-bound inactive state and a GTP-bound active state. NRAS Protein, Human (His, solution) is the recombinant human-derived NRAS protein, expressed by E. coli , with N-His labeled tag.
NRAS, a member of the Ras protein family, is characterized by its ability to bind GDP/GTP and possess intrinsic GTPase activity. This inherent property allows NRAS to actively participate in cellular processes by regulating the cycling between GDP-bound inactive and GTP-bound active states. The dynamic interplay of NRAS with guanine nucleotides underscores its role as a molecular switch, influencing downstream signaling pathways and cellular responses. As a key component in signal transduction cascades, NRAS contributes to the intricate regulation of cellular functions and plays a crucial role in various physiological and pathological processes.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Discov
2024 Jun 28;10(1):70. PMID: 38937452
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P01111 (M1-C186)
-
Molecular Construction
-
N-term
-
His
-
NRAS (M1-C186)
Accession # P01111 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NRAS; Proto-Oncogene GTPase; NRAS Proto-Oncogene, GTPase; N-Ras Protein Part 4; N-Ras; ALPS4; Neuroblastoma RAS Viral (V-Ras) Oncogene Homolog; NRAS1; Neuroblastoma RAS Viral Oncogene Homolog; HRAS1; Transforming Protein N-Ras; CMNS; GTPase NRas; NCMS; V-
-
AA Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
-
Predicted Molecular Mass
23 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
>1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)