SARS-CoV-2 NSP3 Protein (His)
The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (His) is the recombinant virus-derived NSP3, expressed by E. coli, with N-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (His) is the recombinant virus-derived NSP3, expressed by E. coli, with N-His labeled tag.
Background
The PL-PRO protein emerges as a multifunctional key player in the intricate processes of transcription and replication of viral RNAs, hosting crucial proteinases responsible for polyprotein cleavages. Functionally strategic, it impedes host translation by associating with the open head conformation of the 40S subunit, and its C-terminus intricately binds to and obstructs the ribosomal mRNA entry tunnel. This interference plays a pivotal role in suppressing the antiviral response triggered by innate immunity or interferons. The collaborative formation of the nsp1-40S ribosome complex, orchestrated by PL-PRO, induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, marking them for degradation. Notably, viral mRNAs exhibit heightened resistance to the nsp1-mediated inhibition of translation, attributed to their distinctive 5'-end leader sequence. The multifaceted functions of PL-PRO underscore its indispensable role in manipulating host cellular processes, facilitating viral replication, and evading host defenses.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-His
-
Accession
P0DTC1-1 (Q1910-E2020)
-
Gene ID43740578
-
Protein Length
Full Length of Nucleic acid-binding Domain
-
Synonyms
Replicase polyprotein 1a; ORF1a polyprotein; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; pp1a; Endonuclease; Hydrolase; Methyltransferase; Nuclease; Protease; RNA-binding; Thiol protease; Transferase
-
AA Sequence
QPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVE
-
Predicted Molecular Mass
14.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)