SARS-CoV-2 NSP3 Protein (His)

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (His) is the recombinant virus-derived NSP3, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. NSP3 Protein, SARS-CoV-2 (His) is the recombinant virus-derived NSP3, expressed by E. coli, with N-His labeled tag.

Background

The PL-PRO protein emerges as a multifunctional key player in the intricate processes of transcription and replication of viral RNAs, hosting crucial proteinases responsible for polyprotein cleavages. Functionally strategic, it impedes host translation by associating with the open head conformation of the 40S subunit, and its C-terminus intricately binds to and obstructs the ribosomal mRNA entry tunnel. This interference plays a pivotal role in suppressing the antiviral response triggered by innate immunity or interferons. The collaborative formation of the nsp1-40S ribosome complex, orchestrated by PL-PRO, induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, marking them for degradation. Notably, viral mRNAs exhibit heightened resistance to the nsp1-mediated inhibition of translation, attributed to their distinctive 5'-end leader sequence. The multifaceted functions of PL-PRO underscore its indispensable role in manipulating host cellular processes, facilitating viral replication, and evading host defenses.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Nucleic acid-binding Domain

  • Synonyms

    Replicase polyprotein 1a; ORF1a polyprotein; Severe acute respiratory syndrome coronavirus 2; 2019-nCoV; pp1a; Endonuclease; Hydrolase; Methyltransferase; Nuclease; Protease; RNA-binding; Thiol protease; Transferase

  • AA Sequence

    QPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVE

  • Predicted Molecular Mass

    14.8 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00