TrkB Protein, Human (Biotinylated, sf9, Flag, Avi)

The TrkB protein is a key receptor tyrosine kinase that plays a key role in central and peripheral nervous system development. It regulates neuronal survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived NTRK2/TrkB, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

TrkB protein, a receptor tyrosine kinase, plays a critical role in the development and maturation of the central and peripheral nervous systems. It regulates various processes including neuron survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB acts as a receptor for BDNF, NTF4, and also has the ability to bind NTF3, although less efficiently. Upon ligand binding, TrkB undergoes homodimerization, autophosphorylation, and activation. This activates downstream effectors such as SHC1, FRS2, SH2B1, SH2B2, and PLCG1, which control distinct signaling cascades. The GRB2-Ras-MAPK cascade, regulated by SHC1, FRS2, SH2B1, and SH2B2, is involved in neuronal differentiation and neurite outgrowth. The Ras-PI3 kinase-AKT1 cascade, also controlled by these effectors, primarily regulates cell growth and survival. TrkB also plays a role in synaptic plasticity and is involved in learning and memory. Through PLCG1, TrkB activates NF-Kappa-B and promotes the transcription of genes associated with cell survival. Furthermore, TrkB is implicated in neutrophin-dependent calcium signaling in glial cells and facilitates communication between neurons and glia. Overall, TrkB is a crucial player in cell survival and various neural processes.

Human

Sf9 insect cells

N-Avi;N-Flag

Q16620-1 (L456-G822)

4915

Cytoplasmic Domain

Biotin

LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.