1. Recombinant Proteins
  2. Receptor Proteins Enzymes & Regulators Biotinylated Proteins Kinases
  3. Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases TK
  4. Trk Receptors TrkB Trk
  5. TrkB Protein, Human (Biotinylated, sf9, Flag, Avi)

TrkB Protein, Human (Biotinylated, sf9, Flag, Avi)

Cat. No.: HY-P702763
Handling Instructions Technical Support

The TrkB protein is a key receptor tyrosine kinase that plays a key role in central and peripheral nervous system development. It regulates neuronal survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived NTRK2/TrkB, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TrkB protein is a key receptor tyrosine kinase that plays a key role in central and peripheral nervous system development. It regulates neuronal survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB Protein, Human (Biotinylated, sf9, Flag, Avi) is the recombinant human-derived NTRK2/TrkB, expressed by Sf9 insect cells, with Avi, Flag labeled tag.

Background

TrkB protein, a receptor tyrosine kinase, plays a critical role in the development and maturation of the central and peripheral nervous systems. It regulates various processes including neuron survival, proliferation, migration, differentiation, synapse formation, and plasticity. TrkB acts as a receptor for BDNF, NTF4, and also has the ability to bind NTF3, although less efficiently. Upon ligand binding, TrkB undergoes homodimerization, autophosphorylation, and activation. This activates downstream effectors such as SHC1, FRS2, SH2B1, SH2B2, and PLCG1, which control distinct signaling cascades. The GRB2-Ras-MAPK cascade, regulated by SHC1, FRS2, SH2B1, and SH2B2, is involved in neuronal differentiation and neurite outgrowth. The Ras-PI3 kinase-AKT1 cascade, also controlled by these effectors, primarily regulates cell growth and survival. TrkB also plays a role in synaptic plasticity and is involved in learning and memory. Through PLCG1, TrkB activates NF-Kappa-B and promotes the transcription of genes associated with cell survival. Furthermore, TrkB is implicated in neutrophin-dependent calcium signaling in glial cells and facilitates communication between neurons and glia. Overall, TrkB is a crucial player in cell survival and various neural processes.

Species

Human

Source

Sf9 insect cells

Tag

N-Avi;N-Flag

Accession

Q16620-1 (L456-G822)

Gene ID

4915

Protein Length

Cytoplasmic Domain

Conjugation

Biotin

Synonyms
NTRK2; neurotrophic tyrosine kinase, receptor, type 2; BDNF/NT-3 growth factors receptor; trk-B; GP145-TrkB/GP95-TrkB; trkB tyrosine kinase; Neural receptor protein-tyrosine kinase (trkB); Tkrb; trkB; TRKB1; RATTRKB1
AA Sequence

LARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TrkB Protein, Human (Biotinylated, sf9, Flag, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TrkB Protein, Human (Biotinylated, sf9, Flag, Avi)
Cat. No.:
HY-P702763
Quantity:
MCE Japan Authorized Agent: