1. Recombinant Proteins
  2. Viral Proteins
  3. Nucleoprotein/NP Protein, DcCoV (sf9, His)

Dc-CoV Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. Nucleoprotein/NP Protein, DcCoV (sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Dc-CoV Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. Nucleoprotein/NP Protein, DcCoV (sf9, His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Dc-CoV Nucleoprotein (NP, N) is a homodimer composed of 448 amino acids in each chain. NP can be divided into two structural domains interspersed with disordered (unstructured) regions: the N-terminal domain (NTD; also called RBD) serves as a putative RNA-binding domain, while the C-terminal domain (CTD; also called DD) is a dimerization domain, both the NTD and the CTD bind to nucleic acids through electropositive regions on their surfaces.
NP is one of the most abundant coronavirus proteins with nonspecific binding activity toward nucleic acids, including ssRNA, single-stranded DNA, and double-stranded DNA, NP can also act as an RNA chaperone. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication[1].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

AHN64796 (M1-I448)

Gene ID

/

Molecular Construction
N-term
Nucleoprotein (M1-I448)
Accession # AHN64796
His
C-term
Protein Length

Full Length

Synonyms
Dromedary camel coronavirus (DcCoV)(strain HKU23-368F) Nucleoprotein / DcCoV-NP Protein
AA Sequence

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTVTSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNDNLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPFTENTSEI

Predicted Molecular Mass
50.8 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Nucleoprotein/NP Protein, DcCoV (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Nucleoprotein/NP Protein, DcCoV (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nucleoprotein/NP Protein, DcCoV (sf9, His)
Cat. No.:
HY-P76879
Quantity:
MCE Japan Authorized Agent: