1. Recombinant Proteins
  2. Viral Proteins
  3. Nucleoprotein/NP Protein, HCoV-NL63 (His)

HCoV-NL63 Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. Nucleoprotein/NP Protein, HCoV-NL63 (His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by E. coli , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

HCoV-NL63 Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. Nucleoprotein/NP Protein, HCoV-NL63 (His) is the recombinant Virus-derived Nucleoprotein/NP protein, expressed by E. coli , with N-His labeled tag.

Background

HCoV-NL63 Nucleoprotein (NP, N) is a homodimer composed of 377 amino acids in each chain. NP can be divided into two structural domains interspersed with disordered (unstructured) regions: the N-terminal domain (NTD; also called RBD) serves as a putative RNA-binding domain, while the C-terminal domain (CTD; also called DD) is a dimerization domain, both the NTD and the CTD bind to nucleic acids through electropositive regions on their surfaces.
NP is one of the most abundant coronavirus proteins with nonspecific binding activity toward nucleic acids, including ssRNA, single-stranded DNA, and double-stranded DNA, NP can also act as an RNA chaperone. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication[1].

Species

Virus

Source

E. coli

Tag

N-His

Accession

YP_003771.1 (M1-H377)

Gene ID

2943504  [NCBI]

Molecular Construction
N-term
His
Nucleoprotein (M1-H377)
Accession # YP_003771.1
C-term
Protein Length

Full Length

Synonyms
Human coronavirus (HCoV-NL63) Nucleocapsid Protein (His)
AA Sequence

MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Predicted Molecular Mass
43.2 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Nucleoprotein/NP Protein, HCoV-NL63 (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Nucleoprotein/NP Protein, HCoV-NL63 (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Nucleoprotein/NP Protein, HCoV-NL63 (His)
Cat. No.:
HY-P77382
수량:
MCE Japan Authorized Agent: