NUDT5 Protein, Human (His, solution)
Based on 1 Customer Validation
The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His, solution) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His, solution) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.
Background
NUDT5, a versatile enzyme, exhibits dual functionality by acting as an ADP-sugar pyrophosphatase in the absence of diphosphate and catalyzing ATP synthesis in the presence of diphosphate. In the absence of diphosphate, NUDT5 demonstrates hydrolytic activity towards various modified nucleoside diphosphates, including ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP, and 8-oxo-dGDP. Additionally, it can hydrolyze other nucleotide sugars with low activity. When dephosphorylated at Thr-45, NUDT5 facilitates ATP synthesis in the nucleus by converting ADP-ribose to ATP and ribose 5-phosphate. This nuclear ATP generation is crucial for energy-consuming chromatin remodeling events. Despite its diverse enzymatic activities, NUDT5 does not play a role in U8 snoRNA decapping activity, although it exhibits binding affinity for U8 snoRNA.
Verified Bioactivity
Measured by its ability to hydrolyze ADP-ribose (HY-100973A) to AMP and ribose-5-phosphate.The specific activity is 1620.3 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UKK9 (E2-F219)
-
Gene ID11164
-
Molecular Construction
-
N-term
-
His
-
NUDT5 (E2-F219)
Accession # Q9UKK9 -
C-term
-
-
Protein Length
Full length
-
Synonyms
NUDT5; Nucleoside Diphosphate-Linked Moiety X Motif 5; Nudix Hydrolase 5; HYSAH1; YSA1H; HNUDT5; Nuclear ATP-Synthesis Protein NUDIX5; Nudix Motif 5; ADP-Sugar Pyrophosphatase; NUDIX5; 8-Oxo-DGDP Phosphatase; YSAH1; Nudix (Nucleoside Diphosphate Linked Mo
-
AA Sequence
ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
-
Predicted Molecular Mass
25.0 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0, 20% Glycerol, 1 mM EDTA, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
N/A.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)