NXPH1 Protein, Mouse (HEK293, His)

The NXPH1 protein is similar to a neuropeptide, acting as a signaling molecule and acting as a ligand for alpha-neurotoxins.Its role in cell signaling, influencing neural communication through alpha-neurotoxin interactions, highlights its involvement in complex molecular processes and suggests that it plays a key role in regulating cellular functions in neurobiology.NXPH1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

The NXPH1 protein appears to function as a signaling molecule sharing similarities with neuropeptides and serves as a ligand for alpha-neurexins. This suggests that NXPH1 may play a role in cellular signaling, potentially influencing neural communication through its interaction with alpha-neurexins. The identification of NXPH1 as a ligand underscores its involvement in the intricate molecular processes associated with neuronal cell adhesion and suggests a pivotal role in modulating cellular functions within the context of neurobiology. Further investigation into the specific mechanisms and downstream effects of NXPH1's interactions with alpha-neurexins could enhance our understanding of its functional significance in neural signaling pathways.

Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL). The IC₅₀ for this effect is 0.09541 μg/mL.

• 
  Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL) .The IC₅₀ for this effect is 0.09541 μg/mL.

Mouse

HEK293

C-6*His

Q61200 (A22-G271)

18231  [NCBI]

Full Length of Mature Protein

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Approximately 40-55 kDa due to the glycosylation

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.