OMGP Protein, Human (HEK293, His)

The OMGP protein is a cell adhesion molecule that plays a crucial role in the complex myelination process in the central nervous system. Its function involves binding to RTN4R, which facilitates molecular interactions required for fundamental steps in myelination. OMGP Protein, Human (HEK293, His) is the recombinant human-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The OMGP protein is a cell adhesion molecule that plays a crucial role in the complex myelination process in the central nervous system. Its function involves binding to RTN4R, which facilitates molecular interactions required for fundamental steps in myelination. OMGP Protein, Human (HEK293, His) is the recombinant human-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

Background

OMGP protein, a cell adhesion molecule, plays a crucial role in the intricate process of myelination in the central nervous system. Its function involves binding to RTN4R, which contributes to the molecular interactions necessary for the essential steps of myelination. Myelination is a critical process in the development and maintenance of the nervous system, as it involves the formation of a protective myelin sheath around neuronal axons. OMGP's involvement in this process highlights its significance in promoting proper neural communication and ensuring the efficient transmission of electrical signals within the central nervous system.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • OMGP (I25-P416)
      Accession # P23515-1
    • His
    • C-term
  • Protein Length

    Full Length of Oligodendrocyte-myelin glycoprotein Chain

  • Synonyms

    OMG; OMGP; Oligodendrocyte Myelin Glycoprotein; Oligodendrocyte-Myelin Glycoprotein

  • AA Sequence

    ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLP

  • Predicted Molecular Mass

    46 kDa

  • Molecular Weight

    Approximately 120-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00