OMGP Protein, Human (HEK293, His)
The OMGP protein is a cell adhesion molecule that plays a crucial role in the complex myelination process in the central nervous system. Its function involves binding to RTN4R, which facilitates molecular interactions required for fundamental steps in myelination. OMGP Protein, Human (HEK293, His) is the recombinant human-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The OMGP protein is a cell adhesion molecule that plays a crucial role in the complex myelination process in the central nervous system. Its function involves binding to RTN4R, which facilitates molecular interactions required for fundamental steps in myelination. OMGP Protein, Human (HEK293, His) is the recombinant human-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.
Background
OMGP protein, a cell adhesion molecule, plays a crucial role in the intricate process of myelination in the central nervous system. Its function involves binding to RTN4R, which contributes to the molecular interactions necessary for the essential steps of myelination. Myelination is a critical process in the development and maintenance of the nervous system, as it involves the formation of a protective myelin sheath around neuronal axons. OMGP's involvement in this process highlights its significance in promoting proper neural communication and ensuring the efficient transmission of electrical signals within the central nervous system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P23515-1 (I25-P416)
-
Molecular Construction
-
N-term
-
OMGP (I25-P416)
Accession # P23515-1 -
His
-
C-term
-
-
Protein Length
Full Length of Oligodendrocyte-myelin glycoprotein Chain
-
Synonyms
OMG; OMGP; Oligodendrocyte Myelin Glycoprotein; Oligodendrocyte-Myelin Glycoprotein
-
AA Sequence
ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLP
-
Predicted Molecular Mass
46 kDa
-
Molecular Weight
Approximately 120-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)