OMGP Protein, Human (HEK293, His)

The OMGP protein is a cell adhesion molecule that plays a crucial role in the complex myelination process in the central nervous system. Its function involves binding to RTN4R, which facilitates molecular interactions required for fundamental steps in myelination. OMGP Protein, Human (HEK293, His) is the recombinant human-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

OMGP protein, a cell adhesion molecule, plays a crucial role in the intricate process of myelination in the central nervous system. Its function involves binding to RTN4R, which contributes to the molecular interactions necessary for the essential steps of myelination. Myelination is a critical process in the development and maintenance of the nervous system, as it involves the formation of a protective myelin sheath around neuronal axons. OMGP's involvement in this process highlights its significance in promoting proper neural communication and ensuring the efficient transmission of electrical signals within the central nervous system.

Human

HEK293

C-His

P23515-1 (I25-P416)

4974  [NCBI]

Partial

ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLP

Approximately 120-130 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.