omp1 Protein, other (His, Myc)
omp1 Protein, other (His, Myc) is the recombinant omp1 protein, expressed by E. coli, with C-Myc & N-10*His tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
omp1 Protein, other (His, Myc) is the recombinant omp1 protein, expressed by E. coli, with C-Myc & N-10*His tag.
Background
In elementary bodies (EBs, the infectious stage capable of surviving outside the host cell), disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein provide structural integrity to the outer envelope. This structure has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex) and serves as the functional equivalent of peptidoglycan (by similarity).
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag C-Myc;N-10*His
-
Accession
Q46409 (L23-F393)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Major outer membrane porin, serovar D; MOMP; ompA; omp1; CT_681
-
AA Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCATWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENQKTVKAESVPNMSFDQSVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
-
Predicted Molecular Mass
45.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)