1. Recombinant Proteins
  2. Others
  3. omp1 Protein, other (His, Myc)

omp1 Protein, other (His, Myc) is the recombinant omp1 protein, expressed by E. coli, with C-Myc & N-10*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

omp1 Protein, other (His, Myc) is the recombinant omp1 protein, expressed by E. coli, with C-Myc & N-10*His tag.

Background

In elementary bodies (EBs, the infectious stage capable of surviving outside the host cell), disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein provide structural integrity to the outer envelope. This structure has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex) and serves as the functional equivalent of peptidoglycan (by similarity).

Species

Others

Source

E. coli

Tag

C-Myc;N-10*His

Accession

Q46409 (L23-F393)

Gene ID

/

Protein Length

Full Length of Mature Protein

Synonyms
Major outer membrane porin, serovar D; MOMP; ompA; omp1; CT_681
AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCATWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGATSGYLKGNSASFNLVGLFGDNENQKTVKAESVPNMSFDQSVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Predicted Molecular Mass
45.2 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

omp1 Protein, other (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

omp1 Protein, other (His, Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
omp1 Protein, other (His, Myc)
Cat. No.:
HY-P704052
Quantity:
MCE Japan Authorized Agent: